DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and ANKRD53

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001108588.1 Gene:ANKRD53 / 79998 HGNCID:25691 Length:530 Species:Homo sapiens


Alignment Length:199 Identity:62/199 - (31%)
Similarity:94/199 - (47%) Gaps:20/199 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 KETPSD----VQLHMAAMRGDEVALLRVL-DSGKVHVDCKDEDGTTPLILAAAGGHTY----CVM 60
            :|.|:|    ..:|.||..| ::|.|:|| :..|..||....:..|||.|.....:|.    |:.
Human   132 REIPTDDKGFTAIHFAAQWG-KLACLQVLVEEYKFPVDLLTNNSQTPLHLVIHRDNTTVALPCIY 195

  Fly    61 ELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIV 125
            .||::|||.|::...|:|||..||:.|.||.||:|:::||:|....|.|..|:.......|....
Human   196 YLLEKGADLNAQTCNGSTPLHLAARDGLLDCVKVLVQSGANVHAQDAMGYKPIDFCKIWNHRACA 260

  Fly   126 RELLDCGANVNAHMKDRATPVFISAQNGHRTVLSL-----LIQAGAEIDIKRIDGATPLWIAAQM 185
            |.|.|  |......||.|..  ::.....::.|:|     ||:...|..|.| :.|...|:..::
Human   261 RFLKD--AMWKKDKKDFARE--MTKMKMFKSQLTLMEHNYLIEYQKEHKILR-EAAIRKWLHGKL 320

  Fly   186 GQDH 189
            ...|
Human   321 HPGH 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 23/63 (37%)
ANK repeat 13..40 CDD:293786 11/27 (41%)
ANK 37..162 CDD:238125 41/133 (31%)
ANK repeat 42..73 CDD:293786 12/34 (35%)
Ank_2 47..137 CDD:289560 33/93 (35%)
ANK repeat 75..106 CDD:293786 15/30 (50%)
ANK 103..228 CDD:238125 21/92 (23%)
ANK repeat 108..137 CDD:293786 7/28 (25%)
Ank_2 113..202 CDD:289560 18/82 (22%)
ANK repeat 141..171 CDD:293786 7/34 (21%)
ANK 169..292 CDD:238125 5/21 (24%)
ANK repeat 174..204 CDD:293786 3/16 (19%)
Ank_2 179..270 CDD:289560 2/11 (18%)
ANK repeat 207..237 CDD:293786
ANK repeat 239..270 CDD:293786
ANKRD53NP_001108588.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..99
Ank_4 112..160 CDD:290365 10/28 (36%)
ANK 136..263 CDD:238125 44/127 (35%)
ANK 1 139..169 10/30 (33%)
ANK repeat 140..171 CDD:293786 11/31 (35%)
Ank_2 144..241 CDD:289560 38/97 (39%)
ANK repeat 173..208 CDD:293786 12/34 (35%)
ANK 2 173..206 11/32 (34%)
ANK repeat 210..241 CDD:293786 15/30 (50%)
ANK 3 210..239 15/28 (54%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 323..360 1/2 (50%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..402
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.