Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001108588.1 | Gene: | ANKRD53 / 79998 | HGNCID: | 25691 | Length: | 530 | Species: | Homo sapiens |
Alignment Length: | 199 | Identity: | 62/199 - (31%) |
---|---|---|---|
Similarity: | 94/199 - (47%) | Gaps: | 20/199 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 5 KETPSD----VQLHMAAMRGDEVALLRVL-DSGKVHVDCKDEDGTTPLILAAAGGHTY----CVM 60
Fly 61 ELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIV 125
Fly 126 RELLDCGANVNAHMKDRATPVFISAQNGHRTVLSL-----LIQAGAEIDIKRIDGATPLWIAAQM 185
Fly 186 GQDH 189 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 23/63 (37%) |
ANK repeat | 13..40 | CDD:293786 | 11/27 (41%) | ||
ANK | 37..162 | CDD:238125 | 41/133 (31%) | ||
ANK repeat | 42..73 | CDD:293786 | 12/34 (35%) | ||
Ank_2 | 47..137 | CDD:289560 | 33/93 (35%) | ||
ANK repeat | 75..106 | CDD:293786 | 15/30 (50%) | ||
ANK | 103..228 | CDD:238125 | 21/92 (23%) | ||
ANK repeat | 108..137 | CDD:293786 | 7/28 (25%) | ||
Ank_2 | 113..202 | CDD:289560 | 18/82 (22%) | ||
ANK repeat | 141..171 | CDD:293786 | 7/34 (21%) | ||
ANK | 169..292 | CDD:238125 | 5/21 (24%) | ||
ANK repeat | 174..204 | CDD:293786 | 3/16 (19%) | ||
Ank_2 | 179..270 | CDD:289560 | 2/11 (18%) | ||
ANK repeat | 207..237 | CDD:293786 | |||
ANK repeat | 239..270 | CDD:293786 | |||
ANKRD53 | NP_001108588.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..99 | ||
Ank_4 | 112..160 | CDD:290365 | 10/28 (36%) | ||
ANK | 136..263 | CDD:238125 | 44/127 (35%) | ||
ANK 1 | 139..169 | 10/30 (33%) | |||
ANK repeat | 140..171 | CDD:293786 | 11/31 (35%) | ||
Ank_2 | 144..241 | CDD:289560 | 38/97 (39%) | ||
ANK repeat | 173..208 | CDD:293786 | 12/34 (35%) | ||
ANK 2 | 173..206 | 11/32 (34%) | |||
ANK repeat | 210..241 | CDD:293786 | 15/30 (50%) | ||
ANK 3 | 210..239 | 15/28 (54%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 323..360 | 1/2 (50%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 383..402 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |