Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001157107.1 | Gene: | Tnks2 / 74493 | MGIID: | 1921743 | Length: | 1166 | Species: | Mus musculus |
Alignment Length: | 464 | Identity: | 112/464 - (24%) |
---|---|---|---|
Similarity: | 170/464 - (36%) | Gaps: | 157/464 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KKETPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGAD 68
Fly 69 PNSRRLTGTTPLFFAAQGGHLDVVKILIKAGA--------------------------------- 100
Fly 101 -------------------SVDTPSADG--GTPLFVACQGGHVKIVRELLDCGANVNAHMKDRAT 144
Fly 145 PVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMG----------------------- 186
Fly 187 --------------------------------------------------QDH------------ 189
Fly 190 -----ICKVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKYRPNLGQLPN-GESALHAAA 248
Fly 249 MFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSICDYLQERI---RTMVARSAKAMATS 310
Fly 311 GVSSTVKTM 319 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 23/58 (40%) |
ANK repeat | 13..40 | CDD:293786 | 8/26 (31%) | ||
ANK | 37..162 | CDD:238125 | 50/178 (28%) | ||
ANK repeat | 42..73 | CDD:293786 | 14/30 (47%) | ||
Ank_2 | 47..137 | CDD:289560 | 40/143 (28%) | ||
ANK repeat | 75..106 | CDD:293786 | 12/82 (15%) | ||
ANK | 103..228 | CDD:238125 | 46/216 (21%) | ||
ANK repeat | 108..137 | CDD:293786 | 15/30 (50%) | ||
Ank_2 | 113..202 | CDD:289560 | 35/178 (20%) | ||
ANK repeat | 141..171 | CDD:293786 | 8/29 (28%) | ||
ANK | 169..292 | CDD:238125 | 39/213 (18%) | ||
ANK repeat | 174..204 | CDD:293786 | 14/119 (12%) | ||
Ank_2 | 179..270 | CDD:289560 | 32/181 (18%) | ||
ANK repeat | 207..237 | CDD:293786 | 8/29 (28%) | ||
ANK repeat | 239..270 | CDD:293786 | 11/31 (35%) | ||
Tnks2 | NP_001157107.1 | ANK 1 | 23..52 | ||
Ank_4 | 28..78 | CDD:290365 | 8/24 (33%) | ||
ANK | 50..164 | CDD:238125 | 38/111 (34%) | ||
ANK 2 | 57..86 | 11/33 (33%) | |||
ANK repeat | 60..88 | CDD:293786 | 10/32 (31%) | ||
Ank_2 | 62..154 | CDD:289560 | 35/92 (38%) | ||
ANK repeat | 90..121 | CDD:293786 | 14/30 (47%) | ||
ANK 3 | 90..119 | 13/28 (46%) | |||
ANK repeat | 123..154 | CDD:293786 | 11/30 (37%) | ||
ANK 4 | 123..152 | 11/28 (39%) | |||
ANK | 203..317 | CDD:238125 | 30/113 (27%) | ||
ANK 5 | 210..239 | 13/28 (46%) | |||
ANK repeat | 213..241 | CDD:293786 | 14/27 (52%) | ||
Ank_2 | 215..307 | CDD:289560 | 26/91 (29%) | ||
ANK repeat | 243..274 | CDD:293786 | 8/30 (27%) | ||
ANK 6 | 243..272 | 8/28 (29%) | |||
ANK repeat | 276..307 | CDD:293786 | 5/30 (17%) | ||
ANK 7 | 276..305 | 5/28 (18%) | |||
ANK 8 | 363..395 | 8/31 (26%) | |||
ANK repeat | 365..397 | CDD:293786 | 7/31 (23%) | ||
Ank_2 | 368..461 | CDD:289560 | 27/92 (29%) | ||
ANK | 394..579 | CDD:238125 | 34/122 (28%) | ||
ANK repeat | 399..430 | CDD:293786 | 8/30 (27%) | ||
ANK 9 | 399..428 | 8/28 (29%) | |||
ANK 10 | 432..461 | 11/28 (39%) | |||
ANK repeat | 433..521 | CDD:293786 | 25/83 (30%) | ||
Ank_2 | 437..556 | CDD:289560 | 24/79 (30%) | ||
ANK 11 | 463..489 | 8/29 (28%) | |||
ANK | 518..643 | CDD:238125 | |||
ANK 12 | 525..554 | ||||
ANK repeat | 528..556 | CDD:293786 | |||
Ank_2 | 530..622 | CDD:289560 | |||
HIF1AN-binding. /evidence=ECO:0000250|UniProtKB:Q9H2K2 | 545..553 | ||||
ANK repeat | 558..589 | CDD:293786 | |||
ANK 13 | 558..587 | ||||
ANK repeat | 591..622 | CDD:293786 | |||
ANK 14 | 591..620 | ||||
ANK 15 | 624..652 | ||||
ANK repeat | 644..674 | CDD:293786 | |||
ANK | 671..787 | CDD:238125 | |||
ANK 16 | 678..707 | ||||
ANK repeat | 681..709 | CDD:293786 | |||
Ank_2 | 683..775 | CDD:289560 | |||
ANK repeat | 711..742 | CDD:293786 | |||
ANK 17 | 711..740 | ||||
ANK repeat | 744..775 | CDD:293786 | |||
ANK 18 | 744..773 | ||||
SAM_tankyrase1,2 | 871..936 | CDD:188923 | |||
SAM | 877..933 | CDD:197735 | |||
tankyrase_like | 938..1160 | CDD:238718 | |||
PARP | 952..1155 | CDD:279038 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |