DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and Asb12

DIOPT Version :10

Sequence 1:NP_608724.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_543134.1 Gene:Asb12 / 70392 MGIID:1917642 Length:308 Species:Mus musculus


Alignment Length:151 Identity:34/151 - (22%)
Similarity:57/151 - (37%) Gaps:36/151 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   332 QSNGSSNITSTAEDSRNSIG----------LSHWTGPMAFSNRYTSPWERDTNGHLQATSQLSEE 386
            ::|.|.|..|:::..:|.|.          ||. .||     |..||          |:|..|..
Mouse    34 ETNASGNNASSSDSPKNRIASQFRAHLEERLSR-HGP-----RSVSP----------ASSAASSS 82

  Fly   387 SNGSIVK--DRWEFPRHRLKVFNILGEGAFGQVWRCE-ATDIDGHEGVSVTAVKTLKENASE--- 445
            ....:.|  :.||....|....:...:|:.....|.: ..::..:.|..::::...|..:||   
Mouse    83 RRSKVHKPPEGWEPGASRKLSVDASEKGSLTPAMRKKYLKELFLNNGSGLSSILLSKHKSSEEEE 147

  Fly   446 -AERNDLLS---ELQVLKSLE 462
             ||..|.|:   ||..|..:|
Mouse   148 SAEYGDTLNCGYELWALDPME 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_608724.1 ANKYR 13..277 CDD:440430
ANK repeat 13..40 CDD:293786
ANK repeat 42..73 CDD:293786
ANK repeat 75..106 CDD:293786
ANK repeat 108..137 CDD:293786
ANK repeat 141..171 CDD:293786
ANK repeat 174..204 CDD:293786
ANK repeat 207..237 CDD:293786
ANK repeat 239..270 CDD:293786
Asb12NP_543134.1 ANKYR <5..199 CDD:440430 34/151 (23%)
ANK 1 63..92 11/44 (25%)
ANK repeat 66..94 CDD:293786 9/43 (21%)
ANK repeat 96..160 CDD:293786 11/63 (17%)
ANK 2 96..125 3/28 (11%)
ANK 3 129..158 8/28 (29%)
ANK 4 171..200
ANK repeat 173..199 CDD:293786
ANK 5 213..243
SOCS_box 267..306 CDD:462192
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.