DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and Ankrd61

DIOPT Version :10

Sequence 1:NP_608724.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001037762.1 Gene:Ankrd61 / 689907 RGDID:1586393 Length:418 Species:Rattus norvegicus


Alignment Length:287 Identity:71/287 - (24%)
Similarity:117/287 - (40%) Gaps:41/287 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKKETPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILA----------------- 50
            |.::|.....:|:||......:||.:|..| ...:.:|..|.|.|.|.                 
  Rat    69 LSQQTQPIFPIHLAAEYRKPQSLLCLLQHG-ADPEVRDAQGLTTLHLMLLNWPVTSTTWTKPSTR 132

  Fly    51 -------AAGGHTYCVMELLDQGADPNSR--RLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPS 106
                   .......|:..|.|.||..|:|  .....:||..|...|...|:..|.:.||.|:..:
  Rat   133 IQKILTDIQNNAVLCLRILCDHGAQVNARVDNSNKHSPLHLAITYGTYPVLSFLAQNGAQVNAIN 197

  Fly   107 ADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVF------ISAQNGHRTV-----LSL 160
            ....|||.:|....:..::..|:.||||||..:........      .|::.|....     :.|
  Rat   198 ESSMTPLHMAADILNKNMIETLIACGANVNCAISSTGNTALKLAVCTASSKAGRLLAAGVGCIRL 262

  Fly   161 LIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVRCDGATPLFKAAHK-GHAAVI 224
            |:..||:::.:..:|.|.|..|...|::.|..:||:..|||:.:..:|.:|::....: .:...:
  Rat   263 LLNHGAQVNAQDHEGQTALHEACFGGREVIINLLLEFEANVNILTRNGESPIYMYLQRSSNIRDV 327

  Fly   225 TVL--LKYRPNLGQLPNGESALHAAAM 249
            |:|  |.||....:|.|.:.||.|..|
  Rat   328 TLLARLLYRTYPLRLSNKQGALPAGIM 354

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_608724.1 ANKYR 13..277 CDD:440430 69/277 (25%)
ANK repeat 13..40 CDD:293786 7/26 (27%)
ANK repeat 42..73 CDD:293786 11/56 (20%)
ANK repeat 75..106 CDD:293786 9/30 (30%)
ANK repeat 108..137 CDD:293786 10/28 (36%)
ANK repeat 141..171 CDD:293786 6/40 (15%)
ANK repeat 174..204 CDD:293786 11/29 (38%)
ANK repeat 207..237 CDD:293786 7/32 (22%)
ANK repeat 239..270 CDD:293786 5/11 (45%)
Ankrd61NP_001037762.1 ANK 1 27..57
ANK 2 74..103 7/29 (24%)
PHA03095 <78..>118 CDD:222980 12/40 (30%)
ANK repeat 78..105 CDD:293786 7/27 (26%)
ANK repeat 107..164 CDD:293786 11/56 (20%)
ANK 3 131..160 5/28 (18%)
ANKYR 136..334 CDD:440430 48/197 (24%)
ANK 4 166..195 9/28 (32%)
ANK repeat 168..197 CDD:293786 9/28 (32%)
ANK repeat 199..274 CDD:293786 17/74 (23%)
ANK 5 199..228 10/28 (36%)
ANK 6 233..272 6/38 (16%)
ANK repeat 276..305 CDD:293786 11/28 (39%)
ANK 7 276..305 11/28 (39%)
ANK 8 309..342 7/32 (22%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.