Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_080008.1 | Gene: | Ankrd61 / 66729 | MGIID: | 1913979 | Length: | 421 | Species: | Mus musculus |
Alignment Length: | 271 | Identity: | 71/271 - (26%) |
---|---|---|---|
Similarity: | 111/271 - (40%) | Gaps: | 52/271 - (19%) |
- Green bases have known domain annotations that are detailed below.
Fly 3 LKKETPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILA----AAGGHTY------ 57
Fly 58 --------------CVMELLDQGADPNSR--RLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPS 106
Fly 107 ADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIK 171
Fly 172 RIDGATPLWIAAQMGQDHIC-KVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKYRPNLG 235
Fly 236 QLP-NGESALH 245 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 20/82 (24%) |
ANK repeat | 13..40 | CDD:293786 | 7/26 (27%) | ||
ANK | 37..162 | CDD:238125 | 35/150 (23%) | ||
ANK repeat | 42..73 | CDD:293786 | 13/56 (23%) | ||
Ank_2 | 47..137 | CDD:289560 | 28/115 (24%) | ||
ANK repeat | 75..106 | CDD:293786 | 8/30 (27%) | ||
ANK | 103..228 | CDD:238125 | 32/125 (26%) | ||
ANK repeat | 108..137 | CDD:293786 | 9/28 (32%) | ||
Ank_2 | 113..202 | CDD:289560 | 22/89 (25%) | ||
ANK repeat | 141..171 | CDD:293786 | 4/29 (14%) | ||
ANK | 169..292 | CDD:238125 | 26/79 (33%) | ||
ANK repeat | 174..204 | CDD:293786 | 10/30 (33%) | ||
Ank_2 | 179..270 | CDD:289560 | 25/69 (36%) | ||
ANK repeat | 207..237 | CDD:293786 | 10/29 (34%) | ||
ANK repeat | 239..270 | CDD:293786 | 4/7 (57%) | ||
Ankrd61 | NP_080008.1 | ANK 1 | 27..57 | ||
ANK | <32..114 | CDD:238125 | 13/45 (29%) | ||
ANK 2 | 74..103 | 7/29 (24%) | |||
ANK | 78..220 | CDD:238125 | 33/142 (23%) | ||
ANK repeat | 78..105 | CDD:293786 | 7/27 (26%) | ||
Ank_2 | 79..197 | CDD:289560 | 29/118 (25%) | ||
ANK repeat | 107..164 | CDD:293786 | 13/56 (23%) | ||
ANK 3 | 107..146 | 6/38 (16%) | |||
ANK | 164..297 | CDD:238125 | 40/155 (26%) | ||
ANK 4 | 166..195 | 8/28 (29%) | |||
ANK repeat | 168..197 | CDD:293786 | 8/28 (29%) | ||
Ank_2 | 171..274 | CDD:289560 | 33/125 (26%) | ||
ANK repeat | 199..274 | CDD:293786 | 25/97 (26%) | ||
ANK 5 | 199..228 | 9/28 (32%) | |||
ANK 6 | 233..272 | 15/61 (25%) | |||
Ank_5 | 262..316 | CDD:290568 | 21/54 (39%) | ||
ANK repeat | 276..305 | CDD:293786 | 10/28 (36%) | ||
ANK 7 | 276..305 | 10/28 (36%) | |||
ANK 8 | 309..342 | 4/7 (57%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |