DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and Ankrd61

DIOPT Version :10

Sequence 1:NP_608724.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_080008.1 Gene:Ankrd61 / 66729 MGIID:1913979 Length:421 Species:Mus musculus


Alignment Length:271 Identity:71/271 - (26%)
Similarity:111/271 - (40%) Gaps:52/271 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKKETPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILA----AAGGHTY------ 57
            |.::|.....:|:||......:||.:|..| ...:.:|..|.|.|.|.    .|...|:      
Mouse    69 LSQQTQPIFPIHLAAEYRKPQSLLCLLQHG-ADPEVRDAQGFTTLHLMLLNWPASSTTWSKPSTQ 132

  Fly    58 --------------CVMELLDQGADPNSR--RLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPS 106
                          |:..|.|.||..|:|  .....:.|..|...|...|:..|.:.||.|:..:
Mouse   133 IQKILMDIQNNAVLCLCILCDHGAQVNARVDNSNKHSALHLAIIHGTYPVLSFLAQNGAQVNATN 197

  Fly   107 ADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIK 171
            ....|||.:|....:..::..|:..|||||..:....           .|.|.|.: ..|...:.
Mouse   198 ESSMTPLHMAADILNKNMIETLIAFGANVNCAISSTG-----------NTALKLAV-CTASSKVG 250

  Fly   172 RIDGATPLWIAAQMGQDHIC-KVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKYRPNLG 235
            |:       :||.:|    | ::||.|||.|:....:|.|.|.:|...|..|:|::||::..|:.
Mouse   251 RL-------LAAGVG----CIRLLLNNGAQVNAQDHEGQTALHEACFGGREAIISLLLEFEANVN 304

  Fly   236 QLP-NGESALH 245
            .|. ||||.::
Mouse   305 ILTRNGESPIY 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_608724.1 ANKYR 13..277 CDD:440430 69/261 (26%)
ANK repeat 13..40 CDD:293786 7/26 (27%)
ANK repeat 42..73 CDD:293786 13/56 (23%)
ANK repeat 75..106 CDD:293786 8/30 (27%)
ANK repeat 108..137 CDD:293786 9/28 (32%)
ANK repeat 141..171 CDD:293786 4/29 (14%)
ANK repeat 174..204 CDD:293786 10/30 (33%)
ANK repeat 207..237 CDD:293786 10/29 (34%)
ANK repeat 239..270 CDD:293786 4/7 (57%)
Ankrd61NP_080008.1 ANK 1 27..57
PHA02875 28..>227 CDD:165206 39/158 (25%)
ANK 2 74..103 7/29 (24%)
ANK repeat 78..105 CDD:293786 7/27 (26%)
ANK repeat 107..164 CDD:293786 13/56 (23%)
ANK 3 107..146 6/38 (16%)
ANKYR 136..334 CDD:440430 55/203 (27%)
ANK 4 166..195 8/28 (29%)
ANK repeat 168..197 CDD:293786 8/28 (29%)
ANK repeat 199..274 CDD:293786 25/97 (26%)
ANK 5 199..228 9/28 (32%)
ANK 6 233..272 15/61 (25%)
ANK repeat 276..305 CDD:293786 10/28 (36%)
ANK 7 276..305 10/28 (36%)
ANK 8 309..342 4/7 (57%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.