DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and RNASEL

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_066956.1 Gene:RNASEL / 6041 HGNCID:10050 Length:741 Species:Homo sapiens


Alignment Length:309 Identity:88/309 - (28%)
Similarity:136/309 - (44%) Gaps:49/309 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKETPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDED-GTTPLILAAAGGHTYCVMELLDQGA 67
            ::....|..|.:.|::.::|.|::.|..|..:|:.::|: |.|||..|........|..||..||
Human    19 RRAAVEDNHLLIKAVQNEDVDLVQQLLEGGANVNFQEEEGGWTPLHNAVQMSREDIVELLLRHGA 83

  Fly    68 DPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCG 132
            ||..|:..|.||...||..|.:.::|:.:..||.|:.....|.|....|...|.||.::.|...|
Human    84 DPVLRKKNGATPFILAAIAGSVKLLKLFLSKGADVNECDFYGFTAFMEAAVYGKVKALKFLYKRG 148

  Fly   133 ANVNAHMKDR----------ATPVFISAQNGHRTVLSLLI-QAGAEIDIKRIDGATPLWIAAQMG 186
            ||||...|.:          ||.:..:|:.||..||.:|: :.||:::.....|...| |.|.:.
Human   149 ANVNLRRKTKEDQERLRKGGATALMDAAEKGHVEVLKILLDEMGADVNACDNMGRNAL-IHALLS 212

  Fly   187 QDH-----ICKVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKYRPNLGQLPNGESALHA 246
            .|.     |..:||.:||:|:.....|.|||..|..|.|..::..||:..               
Human   213 SDDSDVEAITHLLLDHGADVNVRGERGKTPLILAVEKKHLGLVQRLLEQE--------------- 262

  Fly   247 AAMFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSICDYLQER 295
                 |:.:        :|.   :.||.|||.||.:.|...|.:.|.:|
Human   263 -----HIEI--------NDT---DSDGKTALLLAVELKLKKIAELLCKR 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 20/59 (34%)
ANK repeat 13..40 CDD:293786 7/26 (27%)
ANK 37..162 CDD:238125 44/135 (33%)
ANK repeat 42..73 CDD:293786 12/31 (39%)
Ank_2 47..137 CDD:289560 31/89 (35%)
ANK repeat 75..106 CDD:293786 10/30 (33%)
ANK 103..228 CDD:238125 41/140 (29%)
ANK repeat 108..137 CDD:293786 11/28 (39%)
Ank_2 113..202 CDD:289560 31/104 (30%)
ANK repeat 141..171 CDD:293786 10/40 (25%)
ANK 169..292 CDD:238125 31/127 (24%)
ANK repeat 174..204 CDD:293786 11/34 (32%)
Ank_2 179..270 CDD:289560 21/95 (22%)
ANK repeat 207..237 CDD:293786 9/29 (31%)
ANK repeat 239..270 CDD:293786 2/30 (7%)
RNASELNP_066956.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21 0/1 (0%)
ANK repeat 24..56 CDD:293786 8/31 (26%)
ANK 1 24..53 8/28 (29%)
Ank_2 29..122 CDD:289560 30/92 (33%)
ANK 2 58..87 12/28 (43%)
ANK 59..188 CDD:238125 43/128 (34%)
ANK repeat 59..89 CDD:293786 12/29 (41%)
ANK repeat 91..122 CDD:293786 10/30 (33%)
ANK 3 91..120 10/28 (36%)
Ank_2 96..199 CDD:289560 30/102 (29%)
ANK repeat 124..154 CDD:293786 12/29 (41%)
ANK 4 124..153 11/28 (39%)
ANK repeat 167..199 CDD:293786 10/31 (32%)
ANK 5 167..197 10/29 (34%)
Ank_2 172..270 CDD:289560 30/129 (23%)
ANK 196..321 CDD:238125 33/132 (25%)
ANK repeat 201..236 CDD:293786 11/35 (31%)
ANK 6 201..234 11/33 (33%)
2-5A binding (P-loop) 1 229..242 4/12 (33%)
ANK 7 238..268 10/57 (18%)
Ank_2 243..326 CDD:289560 19/84 (23%)
2-5A binding (P-loop) 2 253..275 6/52 (12%)
ANK repeat 272..326 CDD:293786 11/24 (46%)
ANK 8 272..301 11/24 (46%)
ANK 9 303..329
PKc_like 375..587 CDD:304357
Pkinase 387..586 CDD:278497
RNase_RNase-L 590..708 CDD:199218
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 715..741
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.