Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_066956.1 | Gene: | RNASEL / 6041 | HGNCID: | 10050 | Length: | 741 | Species: | Homo sapiens |
Alignment Length: | 309 | Identity: | 88/309 - (28%) |
---|---|---|---|
Similarity: | 136/309 - (44%) | Gaps: | 49/309 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KKETPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDED-GTTPLILAAAGGHTYCVMELLDQGA 67
Fly 68 DPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCG 132
Fly 133 ANVNAHMKDR----------ATPVFISAQNGHRTVLSLLI-QAGAEIDIKRIDGATPLWIAAQMG 186
Fly 187 QDH-----ICKVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKYRPNLGQLPNGESALHA 246
Fly 247 AAMFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSICDYLQER 295 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 20/59 (34%) |
ANK repeat | 13..40 | CDD:293786 | 7/26 (27%) | ||
ANK | 37..162 | CDD:238125 | 44/135 (33%) | ||
ANK repeat | 42..73 | CDD:293786 | 12/31 (39%) | ||
Ank_2 | 47..137 | CDD:289560 | 31/89 (35%) | ||
ANK repeat | 75..106 | CDD:293786 | 10/30 (33%) | ||
ANK | 103..228 | CDD:238125 | 41/140 (29%) | ||
ANK repeat | 108..137 | CDD:293786 | 11/28 (39%) | ||
Ank_2 | 113..202 | CDD:289560 | 31/104 (30%) | ||
ANK repeat | 141..171 | CDD:293786 | 10/40 (25%) | ||
ANK | 169..292 | CDD:238125 | 31/127 (24%) | ||
ANK repeat | 174..204 | CDD:293786 | 11/34 (32%) | ||
Ank_2 | 179..270 | CDD:289560 | 21/95 (22%) | ||
ANK repeat | 207..237 | CDD:293786 | 9/29 (31%) | ||
ANK repeat | 239..270 | CDD:293786 | 2/30 (7%) | ||
RNASEL | NP_066956.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | 0/1 (0%) | |
ANK repeat | 24..56 | CDD:293786 | 8/31 (26%) | ||
ANK 1 | 24..53 | 8/28 (29%) | |||
Ank_2 | 29..122 | CDD:289560 | 30/92 (33%) | ||
ANK 2 | 58..87 | 12/28 (43%) | |||
ANK | 59..188 | CDD:238125 | 43/128 (34%) | ||
ANK repeat | 59..89 | CDD:293786 | 12/29 (41%) | ||
ANK repeat | 91..122 | CDD:293786 | 10/30 (33%) | ||
ANK 3 | 91..120 | 10/28 (36%) | |||
Ank_2 | 96..199 | CDD:289560 | 30/102 (29%) | ||
ANK repeat | 124..154 | CDD:293786 | 12/29 (41%) | ||
ANK 4 | 124..153 | 11/28 (39%) | |||
ANK repeat | 167..199 | CDD:293786 | 10/31 (32%) | ||
ANK 5 | 167..197 | 10/29 (34%) | |||
Ank_2 | 172..270 | CDD:289560 | 30/129 (23%) | ||
ANK | 196..321 | CDD:238125 | 33/132 (25%) | ||
ANK repeat | 201..236 | CDD:293786 | 11/35 (31%) | ||
ANK 6 | 201..234 | 11/33 (33%) | |||
2-5A binding (P-loop) 1 | 229..242 | 4/12 (33%) | |||
ANK 7 | 238..268 | 10/57 (18%) | |||
Ank_2 | 243..326 | CDD:289560 | 19/84 (23%) | ||
2-5A binding (P-loop) 2 | 253..275 | 6/52 (12%) | |||
ANK repeat | 272..326 | CDD:293786 | 11/24 (46%) | ||
ANK 8 | 272..301 | 11/24 (46%) | |||
ANK 9 | 303..329 | ||||
PKc_like | 375..587 | CDD:304357 | |||
Pkinase | 387..586 | CDD:278497 | |||
RNase_RNase-L | 590..708 | CDD:199218 | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 715..741 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |