DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG3104 and pidd1

DIOPT Version :9

Sequence 1:	NP_001259969.1	Gene:	CG3104 / 33486	FlyBaseID:	FBgn0031473	Length:	321	Species:	Drosophila melanogaster
Sequence 2:	XP_021326274.1	Gene:	pidd1 / 571033	ZFINID:	ZDB-GENE-081104-353	Length:	960	Species:	Danio rerio

Alignment Length:	126	Identity:	27/126 - (21%)
Similarity:	41/126 - (32%)	Gaps:	41/126 - (32%)

- Green bases have known domain annotations that are detailed below.

  Fly   191 CKVLLQNGANVDTVR-CDGATPLFKAAHK----------GHAAVITVLLKYRPNLGQLPNGESAL 244
            |.|.|..||.:...| |.|.....:.|.|          .|..:::..|:.||
Zfish   377 CHVFLPGGAELLFPRQCVGVVTQLQWAEKRPDRKWVWLEEHDVLLSRQLELRP------------ 429

  Fly   245 HAAAMFGHMTVC-KQLVAAGSDVLLKNHDGLTALQLAHQQKYTSICDYLQERIRTMVARSA 304
            |.|.....:.|| ........||:::..||         |.:|:        :.||..|.:
Zfish   430 HGATFEKLVGVCIPYRKTRKGDVVVRRFDG---------QSWTT--------LTTMTRRGS 473

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG3104	NP_001259969.1	Ank_2	<13..72	CDD:289560
		ANK repeat	13..40	CDD:293786
		ANK	37..162	CDD:238125
		ANK repeat	42..73	CDD:293786
		Ank_2	47..137	CDD:289560
		ANK repeat	75..106	CDD:293786
		ANK	103..228	CDD:238125	11/47 (23%)
		ANK repeat	108..137	CDD:293786
		Ank_2	113..202	CDD:289560	5/10 (50%)
		ANK repeat	141..171	CDD:293786
		ANK	169..292	CDD:238125	24/112 (21%)
		ANK repeat	174..204	CDD:293786	5/12 (42%)
		Ank_2	179..270	CDD:289560	20/90 (22%)
		ANK repeat	207..237	CDD:293786	7/39 (18%)
		ANK repeat	239..270	CDD:293786	6/31 (19%)
pidd1	XP_021326274.1	LRR	<148..366	CDD:227223
		leucine-rich repeat	154..188	CDD:275380
		leucine-rich repeat	189..211	CDD:275380
		leucine-rich repeat	212..234	CDD:275380
		leucine-rich repeat	235..258	CDD:275380
		leucine-rich repeat	259..280	CDD:275380
		leucine-rich repeat	281..303	CDD:275380
		leucine-rich repeat	304..326	CDD:275380
		Peptidase_S68	462..501	CDD:313651	4/20 (20%)
		DD	846..932	CDD:326335
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E2759_KOG4177
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.900