DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and ankdd1a

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001092718.1 Gene:ankdd1a / 569271 ZFINID:ZDB-GENE-070615-8 Length:489 Species:Danio rerio


Alignment Length:326 Identity:90/326 - (27%)
Similarity:151/326 - (46%) Gaps:22/326 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNSRR 73
            |:.:.|.||.|.|...:..::..| |.:..|::.....|..||..|....:..|||...|.:...
Zfish    15 SEKEFHDAAKRNDTERMQELISRG-VDIKVKNKMDRKALHWAAGAGSEQALRLLLDHDMDVDDMD 78

  Fly    74 LTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAH 138
            ..|...|..||..|||.::|||:..||.:.|.:.:|...|..|.|.||:.|:..:::...||..:
Zfish    79 SFGMNALLLAAWFGHLTILKILVSTGAKLTTENKNGLNLLHCAAQRGHITILEYIMEDLENVQLN 143

  Fly   139 MKDRA--TPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANV 201
            ..:.:  |...::|::||..|:..||..|...::|...|.|.|.:||:.|...:.:.:::.|.|:
Zfish   144 KVENSGKTAFHLAAEHGHLEVVEFLIGMGCAHNLKDKHGNTALHLAAKQGHSDVLQKIMETGENI 208

  Fly   202 DTVRCDGATPLFKAAHKGHAAVITVLLKYRPNLGQLPNGE-SALHAAAMFGHMTVCKQLVAAGSD 265
            |....||.|.|..|:..||...|.:||:...|:.:|.:.: :|||..|.....:..:.|:.||.:
Zfish   209 DERNIDGMTALHLASEGGHYECIRLLLEAGCNVNELTDSKRTALHLVAQHASASEVRLLIQAGIN 273

  Fly   266 VLLKNHDGLTALQLAHQQKYTSI--------C--DYLQERIRTMV--------ARSAKAMATSGV 312
            :...:...::||.||.....|.|        |  |....|::|.:        ...|:.:..|||
Zfish   274 LDSVDTQHVSALHLAVLNNSTEIVKDLIEAGCDLDIFDNRLQTALHIAAEHGRLNIAETILISGV 338

  Fly   313 S 313
            :
Zfish   339 N 339

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 16/58 (28%)
ANK repeat 13..40 CDD:293786 7/26 (27%)
ANK 37..162 CDD:238125 36/126 (29%)
ANK repeat 42..73 CDD:293786 8/30 (27%)
Ank_2 47..137 CDD:289560 30/89 (34%)
ANK repeat 75..106 CDD:293786 13/30 (43%)
ANK 103..228 CDD:238125 36/126 (29%)
ANK repeat 108..137 CDD:293786 9/28 (32%)
Ank_2 113..202 CDD:289560 25/90 (28%)
ANK repeat 141..171 CDD:293786 8/31 (26%)
ANK 169..292 CDD:238125 37/133 (28%)
ANK repeat 174..204 CDD:293786 9/29 (31%)
Ank_2 179..270 CDD:289560 26/91 (29%)
ANK repeat 207..237 CDD:293786 11/29 (38%)
ANK repeat 239..270 CDD:293786 7/31 (23%)
ankdd1aNP_001092718.1 ANK 19..134 CDD:238125 36/115 (31%)
Ank_2 19..111 CDD:289560 29/92 (32%)
ANK repeat 19..45 CDD:293786 7/26 (27%)
ANK repeat 47..78 CDD:293786 8/30 (27%)
ANK 79..202 CDD:238125 37/122 (30%)
ANK repeat 80..111 CDD:293786 13/30 (43%)
Ank_2 85..179 CDD:289560 29/93 (31%)
ANK repeat 113..146 CDD:293786 9/32 (28%)
ANK 143..268 CDD:238125 34/124 (27%)
ANK repeat 148..179 CDD:293786 8/30 (27%)
Ank_2 153..242 CDD:289560 28/88 (32%)
ANK repeat 181..212 CDD:293786 9/30 (30%)
ANK 209..334 CDD:238125 31/124 (25%)
ANK repeat 214..242 CDD:293786 11/27 (41%)
ANK repeat 247..278 CDD:293786 7/30 (23%)
Ank_2 252..344 CDD:289560 20/88 (23%)
ANK repeat 280..311 CDD:293786 8/30 (27%)
ANK repeat 313..344 CDD:293786 6/27 (22%)
DD 402..474 CDD:301326
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53592
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.