| Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_021331690.1 | Gene: | ank2a / 568926 | ZFINID: | ZDB-GENE-111215-3 | Length: | 4856 | Species: | Danio rerio |
| Alignment Length: | 317 | Identity: | 106/317 - (33%) |
|---|---|---|---|
| Similarity: | 158/317 - (49%) | Gaps: | 43/317 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 TPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNS 71
Fly 72 RRLTGTTPLFFAAQGGHLDVVKILIKAGASVD------------------------------TPS 106
Fly 107 A---DGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEI 168
Fly 169 DIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKY--R 231
Fly 232 PNLGQLPNGESALHAAAMFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSI 288 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 24/58 (41%) |
| ANK repeat | 13..40 | CDD:293786 | 9/26 (35%) | ||
| ANK | 37..162 | CDD:238125 | 51/157 (32%) | ||
| ANK repeat | 42..73 | CDD:293786 | 14/30 (47%) | ||
| Ank_2 | 47..137 | CDD:289560 | 37/122 (30%) | ||
| ANK repeat | 75..106 | CDD:293786 | 13/60 (22%) | ||
| ANK | 103..228 | CDD:238125 | 47/157 (30%) | ||
| ANK repeat | 108..137 | CDD:293786 | 11/28 (39%) | ||
| Ank_2 | 113..202 | CDD:289560 | 34/88 (39%) | ||
| ANK repeat | 141..171 | CDD:293786 | 12/29 (41%) | ||
| ANK | 169..292 | CDD:238125 | 41/122 (34%) | ||
| ANK repeat | 174..204 | CDD:293786 | 14/29 (48%) | ||
| Ank_2 | 179..270 | CDD:289560 | 30/92 (33%) | ||
| ANK repeat | 207..237 | CDD:293786 | 8/31 (26%) | ||
| ANK repeat | 239..270 | CDD:293786 | 10/30 (33%) | ||
| ank2a | XP_021331690.1 | ANK | <40..98 | CDD:238125 | |
| ANK repeat | 44..75 | CDD:293786 | |||
| ANK | 74..197 | CDD:238125 | |||
| ANK repeat | 77..108 | CDD:293786 | |||
| ANK repeat | 110..141 | CDD:293786 | |||
| ANK repeat | 143..168 | CDD:293786 | |||
| Ank_4 | 206..270 | CDD:316185 | |||
| ANK repeat | 209..236 | CDD:293786 | |||
| ANK | 248..369 | CDD:238125 | 36/88 (41%) | ||
| ANK repeat | 249..280 | CDD:293786 | |||
| ANK repeat | 282..313 | CDD:293786 | 11/32 (34%) | ||
| ANK | 310..435 | CDD:238125 | 40/124 (32%) | ||
| ANK repeat | 315..346 | CDD:293786 | 14/30 (47%) | ||
| ANK repeat | 348..379 | CDD:293786 | 13/30 (43%) | ||
| ANK repeat | 381..411 | CDD:293786 | 1/29 (3%) | ||
| ANK | 409..534 | CDD:238125 | 45/124 (36%) | ||
| ANK repeat | 414..445 | CDD:293786 | 12/30 (40%) | ||
| ANK repeat | 447..478 | CDD:293786 | 12/30 (40%) | ||
| ANK | 475..600 | CDD:238125 | 41/122 (34%) | ||
| ANK repeat | 480..511 | CDD:293786 | 14/30 (47%) | ||
| ANK repeat | 513..542 | CDD:293786 | 8/29 (28%) | ||
| ANK repeat | 546..571 | CDD:293786 | 8/24 (33%) | ||
| ANK | 578..699 | CDD:238125 | 7/18 (39%) | ||
| ANK repeat | 579..607 | CDD:293786 | 7/17 (41%) | ||
| ANK repeat | 612..643 | CDD:293786 | |||
| ANK repeat | 645..676 | CDD:293786 | |||
| ANK | 673..798 | CDD:238125 | |||
| ANK repeat | 678..707 | CDD:293786 | |||
| ANK repeat | 711..742 | CDD:293786 | |||
| ANK repeat | 744..775 | CDD:293786 | |||
| ANK repeat | 777..807 | CDD:293786 | |||
| Ank_4 | 778..830 | CDD:316185 | |||
| ZU5 | 999..1136 | CDD:128514 | |||
| DD | 3434..3517 | CDD:326335 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 1 | 1.000 | - | - | ||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| ZFIN | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.900 | |||||