Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009293648.1 | Gene: | tnksa / 559022 | ZFINID: | ZDB-GENE-030131-7450 | Length: | 1259 | Species: | Danio rerio |
Alignment Length: | 471 | Identity: | 110/471 - (23%) |
---|---|---|---|
Similarity: | 170/471 - (36%) | Gaps: | 158/471 - (33%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSLKKETPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQ 65
Fly 66 GADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADG--------------------- 109
Fly 110 ----------------------------------------GTPLFVACQGGHVKIVRELLDCGAN 134
Fly 135 VNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGA 199
Fly 200 NVDTVRCDG-------------------------------------------------------- 208
Fly 209 ----------------------------------ATPLFKAAHKGHAAVITVLLKYRPNLGQLPN 239
Fly 240 -GESALHAAAMFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSICDYLQERIRTMVARS 303
Fly 304 AKAMATSGVSSTVKTM 319 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 24/58 (41%) |
ANK repeat | 13..40 | CDD:293786 | 8/26 (31%) | ||
ANK | 37..162 | CDD:238125 | 49/185 (26%) | ||
ANK repeat | 42..73 | CDD:293786 | 15/30 (50%) | ||
Ank_2 | 47..137 | CDD:289560 | 39/150 (26%) | ||
ANK repeat | 75..106 | CDD:293786 | 11/30 (37%) | ||
ANK | 103..228 | CDD:238125 | 44/275 (16%) | ||
ANK repeat | 108..137 | CDD:293786 | 14/89 (16%) | ||
Ank_2 | 113..202 | CDD:289560 | 30/88 (34%) | ||
ANK repeat | 141..171 | CDD:293786 | 8/29 (28%) | ||
ANK | 169..292 | CDD:238125 | 38/213 (18%) | ||
ANK repeat | 174..204 | CDD:293786 | 10/29 (34%) | ||
Ank_2 | 179..270 | CDD:289560 | 32/181 (18%) | ||
ANK repeat | 207..237 | CDD:293786 | 10/119 (8%) | ||
ANK repeat | 239..270 | CDD:293786 | 12/31 (39%) | ||
tnksa | XP_009293648.1 | Ank_4 | 111..161 | CDD:290365 | 9/27 (33%) |
ANK | 133..247 | CDD:238125 | 42/114 (37%) | ||
ANK repeat | 143..171 | CDD:293786 | 10/32 (31%) | ||
Ank_2 | 145..237 | CDD:289560 | 36/92 (39%) | ||
ANK repeat | 173..204 | CDD:293786 | 15/30 (50%) | ||
ANK | 201..387 | CDD:238125 | 43/185 (23%) | ||
ANK repeat | 206..237 | CDD:293786 | 11/30 (37%) | ||
ANK repeat | 303..331 | CDD:293786 | 13/27 (48%) | ||
Ank_2 | 305..397 | CDD:289560 | 30/91 (33%) | ||
ANK repeat | 333..364 | CDD:293786 | 8/30 (27%) | ||
ANK repeat | 366..397 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 455..487 | CDD:293786 | 0/31 (0%) | ||
Ank_2 | 458..552 | CDD:289560 | 21/93 (23%) | ||
ANK | 484..669 | CDD:238125 | 33/119 (28%) | ||
ANK repeat | 489..520 | CDD:293786 | 9/30 (30%) | ||
ANK repeat | 522..552 | CDD:293786 | 12/29 (41%) | ||
Ank_2 | 527..646 | CDD:289560 | 22/76 (29%) | ||
ANK | 608..733 | CDD:238125 | |||
ANK repeat | 618..646 | CDD:293786 | |||
Ank_2 | 620..712 | CDD:289560 | |||
ANK repeat | 648..679 | CDD:293786 | |||
ANK repeat | 681..712 | CDD:293786 | |||
ANK repeat | 734..764 | CDD:293786 | |||
Ank_4 | 735..789 | CDD:290365 | |||
ANK | 761..885 | CDD:238125 | |||
ANK repeat | 768..799 | CDD:293786 | |||
Ank_2 | 773..865 | CDD:289560 | |||
ANK repeat | 801..832 | CDD:293786 | |||
ANK repeat | 834..865 | CDD:293786 | |||
SAM_tankyrase1,2 | 958..1021 | CDD:188923 | |||
SAM | 962..1019 | CDD:197735 | |||
tankyrase_like | 1023..1245 | CDD:238718 | |||
PARP | 1037..1240 | CDD:279038 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |