DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and PIDD1

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_005253062.1 Gene:PIDD1 / 55367 HGNCID:16491 Length:934 Species:Homo sapiens


Alignment Length:177 Identity:42/177 - (23%)
Similarity:65/177 - (36%) Gaps:41/177 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VQLHMAAMRGDEVALLRVLDSGKVHVDC---KDEDGTTPLILAAAGGHTYCVMELLD--QGADPN 70
            ::||    |.:.:||.|..|..:|.:.|   ...|.|              :..||:  :|.:|:
Human   635 LRLH----RVNLIALQRRRDPEQVLLQCLPRNKVDAT--------------LRRLLERYRGPEPS 681

  Fly    71 SRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANV 135
            ..........||||....:||         ..|.|....|...||..  .|:|.|:|:.     |
Human   682 DTVEMFEGEEFFAAFERGIDV---------DADRPDCVEGRICFVFY--SHLKNVKEVY-----V 730

  Fly   136 NAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIA 182
            ...: ||.........:.:|..:.:.:...||...:| .||..||:|
Human   731 TTTL-DREAQAVRGQVSFYRGAVPVRVPEEAEAARQR-KGADALWMA 775

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 15/63 (24%)
ANK repeat 13..40 CDD:293786 9/29 (31%)
ANK 37..162 CDD:238125 26/129 (20%)
ANK repeat 42..73 CDD:293786 6/32 (19%)
Ank_2 47..137 CDD:289560 20/91 (22%)
ANK repeat 75..106 CDD:293786 7/30 (23%)
ANK 103..228 CDD:238125 21/80 (26%)
ANK repeat 108..137 CDD:293786 8/28 (29%)
Ank_2 113..202 CDD:289560 18/70 (26%)
ANK repeat 141..171 CDD:293786 5/29 (17%)
ANK 169..292 CDD:238125 6/14 (43%)
ANK repeat 174..204 CDD:293786 5/9 (56%)
Ank_2 179..270 CDD:289560 3/4 (75%)
ANK repeat 207..237 CDD:293786
ANK repeat 239..270 CDD:293786
PIDD1XP_005253062.1 leucine-rich repeat 39..63 CDD:275380
leucine-rich repeat 64..91 CDD:275380
LRR_RI <117..>279 CDD:238064
LRR_8 126..183 CDD:290566
leucine-rich repeat 127..152 CDD:275380
leucine-rich repeat 153..172 CDD:275380
leucine-rich repeat 173..195 CDD:275380
LRR_8 194..252 CDD:290566
leucine-rich repeat 196..218 CDD:275380
leucine-rich repeat 219..241 CDD:275380
LRR_8 240..295 CDD:290566
leucine-rich repeat 242..264 CDD:275380
leucine-rich repeat 265..286 CDD:275380
ZU5 325..398 CDD:295340
Peptidase_S68 421..453 CDD:287439
ZU5 465..537 CDD:295340
Death_PIDD 812..897 CDD:260049
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.