DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and asb4

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001017628.1 Gene:asb4 / 550321 ZFINID:ZDB-GENE-050417-100 Length:435 Species:Danio rerio


Alignment Length:314 Identity:80/314 - (25%)
Similarity:122/314 - (38%) Gaps:81/314 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 AAMRGDEVALLRVLDSGKVHV----DCKDEDGTTPLILA-----------------AAGGHT--- 56
            |.:|.|...:.|:|.:..:.:    |.:|.|    ::||                 |.|.|.   
Zfish    34 ALLRNDAAEVARILRTTSIDIDTVLDVEDRD----MVLASYKQGYWLPSYKLETSWAMGLHVCMM 94

  Fly    57 YCVME----LLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVAC 117
            |..:|    ||..||..| |:..|.|||..|......|.|.:|::.||.:::.|..|.|||    
Zfish    95 YSALESAVVLLQNGAAVN-RKPNGKTPLHVACTVASADCVGLLLEWGARINSMSLSGHTPL---- 154

  Fly   118 QGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGA-TPLWI 181
               |..|..|.|||.                          .||:..||::::...:.. |||..
Zfish   155 ---HYCITPESLDCA--------------------------KLLVLKGAKLNMPSEEHEDTPLHT 190

  Fly   182 AAQMGQDHICKVLLQNGANVDTVRCDGATPLFKAA-----------HKGHAAVITVLLKYRPNLG 235
            ||:.|...:....:.:||.::.|.|...|||..|.           ...|..|..:||.:..||.
Zfish   191 AARYGLPELVAFYIAHGAAINAVNCYRETPLITAVFWAMDIRERTYSSDHHLVCRILLDHNANLH 255

  Fly   236 -QLPNGESALHAAAMFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSI 288
             |..:.::|||.|.......:.:.|:.||:.....:.:|..|:|  :..|.|.|
Zfish   256 MQEEDKKTALHKACWNCDHVLVQMLLEAGAQANDMDVNGCAAIQ--YVLKVTQI 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 20/83 (24%)
ANK repeat 13..40 CDD:293786 6/27 (22%)
ANK 37..162 CDD:238125 38/148 (26%)
ANK repeat 42..73 CDD:293786 13/54 (24%)
Ank_2 47..137 CDD:289560 34/113 (30%)
ANK repeat 75..106 CDD:293786 10/30 (33%)
ANK 103..228 CDD:238125 31/136 (23%)
ANK repeat 108..137 CDD:293786 10/28 (36%)
Ank_2 113..202 CDD:289560 19/89 (21%)
ANK repeat 141..171 CDD:293786 4/29 (14%)
ANK 169..292 CDD:238125 34/133 (26%)
ANK repeat 174..204 CDD:293786 8/30 (27%)
Ank_2 179..270 CDD:289560 26/102 (25%)
ANK repeat 207..237 CDD:293786 10/41 (24%)
ANK repeat 239..270 CDD:293786 7/30 (23%)
asb4NP_001017628.1 ANK repeat 116..147 CDD:293786 10/30 (33%)
Ank_2 121..214 CDD:289560 30/125 (24%)
ANK 144..281 CDD:238125 40/169 (24%)
ANK repeat 149..181 CDD:293786 14/64 (22%)
ANK repeat 183..214 CDD:293786 8/30 (27%)
Ank_2 188..291 CDD:289560 26/102 (25%)
ANK repeat 216..258 CDD:293786 10/41 (24%)
ANK 256..>325 CDD:238125 14/54 (26%)
ANK repeat 260..291 CDD:293786 7/30 (23%)
SOCS_ASB4_ASB18 388..435 CDD:239693
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.