DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and ANKMY1

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_016859764.1 Gene:ANKMY1 / 51281 HGNCID:20987 Length:1131 Species:Homo sapiens


Alignment Length:276 Identity:72/276 - (26%)
Similarity:105/276 - (38%) Gaps:89/276 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 LLDQGADPNSRRLTGTTP---LFFAAQGGHLDVVKILIKAGASVD---TPSADGGTPLFVAC--- 117
            ||.:|||||    ....|   ||.|.:.|.:|.|::|::.||..|   .|.....|||.:|.   
Human   622 LLRRGADPN----LCCVPMQVLFLAVKAGDVDGVRLLLEHGARTDICFPPQLSTLTPLHIAAALP 682

  Fly   118 --QGGHVKIVRELLDCGANVNAHMKDR----------ATPVFISAQN------GHRTVLSLLIQA 164
              :|  |:||..||....:|:|...|.          ..|..:...|      .:.:..:.|.:.
Human   683 GEEG--VQIVELLLHAITDVDAKASDEDDTYKPGKLDLLPSSLKLSNEPGPPQAYYSTDTALPEE 745

  Fly   165 GAEIDIKRIDGATPLWIAAQMGQDHIC-----KVLLQNGANVDTVRCDGATPLFKAAHKGHAAVI 224
            |         |.|.|.:|.:...|:.|     ::||.:|||                        
Human   746 G---------GRTALHMACEREDDNKCARDIVRLLLSHGAN------------------------ 777

  Fly   225 TVLLKYRPNLGQLPNGESALHAAAMFGHMTVCKQLVAAGSDVLLKNHDGL-TALQLAHQQKYTSI 288
                   |||  |.:|.|.|..:...|:..|.|:|:..|:|..|....|| :||.:|        
Human   778 -------PNL--LWSGHSPLSLSIASGNELVVKELLTQGADPNLPLTKGLGSALCVA-------- 825

  Fly   289 CDYLQERIRTMVARSA 304
            ||...|..|.|.::.|
Human   826 CDLTYEHQRNMDSKLA 841

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 7/9 (78%)
ANK repeat 13..40 CDD:293786
ANK 37..162 CDD:238125 34/126 (27%)
ANK repeat 42..73 CDD:293786 7/10 (70%)
Ank_2 47..137 CDD:289560 30/85 (35%)
ANK repeat 75..106 CDD:293786 11/36 (31%)
ANK 103..228 CDD:238125 30/153 (20%)
ANK repeat 108..137 CDD:293786 11/33 (33%)
Ank_2 113..202 CDD:289560 26/114 (23%)
ANK repeat 141..171 CDD:293786 5/45 (11%)
ANK 169..292 CDD:238125 32/128 (25%)
ANK repeat 174..204 CDD:293786 11/34 (32%)
Ank_2 179..270 CDD:289560 23/95 (24%)
ANK repeat 207..237 CDD:293786 3/29 (10%)
ANK repeat 239..270 CDD:293786 10/30 (33%)
ANKMY1XP_016859764.1 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.