DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and Asb12

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001032444.1 Gene:Asb12 / 503446 RGDID:1561142 Length:308 Species:Rattus norvegicus


Alignment Length:229 Identity:69/229 - (30%)
Similarity:103/229 - (44%) Gaps:35/229 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 KKETPSDV----QLHMAAMRGDEVALLRVLDSGKVHVDCKDEDG----TTPLILAAAGGHTYCVM 60
            |:|..:|.    .|:.|....|...|..:|...:.........|    .|||.|||:.||..||.
  Rat    17 KEEEDADTGEKQALNQAVYDNDSCTLDHLLHQERYKRFINSRSGWGIPGTPLRLAASYGHLDCVK 81

  Fly    61 ELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIV 125
            .||:.|||.:|..:...||||.|...|||:.|:||::|||.......:..:|:..|.:.|...|:
  Rat    82 VLLEHGADVDSLDVKAQTPLFTAVSHGHLECVRILLEAGACPSGSIYNNCSPVLTASRDGAFAIL 146

  Fly   126 RELLDCGANVNAHMK---------DRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWI 181
            :|||..||..|...|         ..:.|::::|..||.....||:..||:.|...||.|    :
  Rat   147 QELLGHGAEANVKAKLPVWASNIASCSGPLYLAAVYGHLDCFRLLLLYGADPDYNCIDQA----L 207

  Fly   182 AAQMGQ---------DHIC-----KVLLQNGANV 201
            .:::.|         .|.|     ::|:..|||:
  Rat   208 LSRVPQPRTLLEICLHHNCEPEYIQLLIDFGANI 241

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 21/62 (34%)
ANK repeat 13..40 CDD:293786 5/26 (19%)
ANK 37..162 CDD:238125 47/137 (34%)
ANK repeat 42..73 CDD:293786 17/34 (50%)
Ank_2 47..137 CDD:289560 37/89 (42%)
ANK repeat 75..106 CDD:293786 14/30 (47%)
ANK 103..228 CDD:238125 30/122 (25%)
ANK repeat 108..137 CDD:293786 9/28 (32%)
Ank_2 113..202 CDD:289560 29/112 (26%)
ANK repeat 141..171 CDD:293786 9/29 (31%)
ANK 169..292 CDD:238125 11/47 (23%)
ANK repeat 174..204 CDD:293786 9/42 (21%)
Ank_2 179..270 CDD:289560 7/37 (19%)
ANK repeat 207..237 CDD:293786
ANK repeat 239..270 CDD:293786
Asb12NP_001032444.1 ANK repeat 66..94 CDD:293786 16/27 (59%)
Ank_2 68..159 CDD:403870 38/90 (42%)
ANK repeat 96..160 CDD:293786 24/63 (38%)
ANK repeat 173..199 CDD:293786 8/25 (32%)
Ank 175..199 CDD:394980 8/23 (35%)
SOCS_box 268..306 CDD:400074
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24120
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.