Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001032444.1 | Gene: | Asb12 / 503446 | RGDID: | 1561142 | Length: | 308 | Species: | Rattus norvegicus |
Alignment Length: | 229 | Identity: | 69/229 - (30%) |
---|---|---|---|
Similarity: | 103/229 - (44%) | Gaps: | 35/229 - (15%) |
- Green bases have known domain annotations that are detailed below.
Fly 4 KKETPSDV----QLHMAAMRGDEVALLRVLDSGKVHVDCKDEDG----TTPLILAAAGGHTYCVM 60
Fly 61 ELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIV 125
Fly 126 RELLDCGANVNAHMK---------DRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWI 181
Fly 182 AAQMGQ---------DHIC-----KVLLQNGANV 201 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 21/62 (34%) |
ANK repeat | 13..40 | CDD:293786 | 5/26 (19%) | ||
ANK | 37..162 | CDD:238125 | 47/137 (34%) | ||
ANK repeat | 42..73 | CDD:293786 | 17/34 (50%) | ||
Ank_2 | 47..137 | CDD:289560 | 37/89 (42%) | ||
ANK repeat | 75..106 | CDD:293786 | 14/30 (47%) | ||
ANK | 103..228 | CDD:238125 | 30/122 (25%) | ||
ANK repeat | 108..137 | CDD:293786 | 9/28 (32%) | ||
Ank_2 | 113..202 | CDD:289560 | 29/112 (26%) | ||
ANK repeat | 141..171 | CDD:293786 | 9/29 (31%) | ||
ANK | 169..292 | CDD:238125 | 11/47 (23%) | ||
ANK repeat | 174..204 | CDD:293786 | 9/42 (21%) | ||
Ank_2 | 179..270 | CDD:289560 | 7/37 (19%) | ||
ANK repeat | 207..237 | CDD:293786 | |||
ANK repeat | 239..270 | CDD:293786 | |||
Asb12 | NP_001032444.1 | ANK repeat | 66..94 | CDD:293786 | 16/27 (59%) |
Ank_2 | 68..159 | CDD:403870 | 38/90 (42%) | ||
ANK repeat | 96..160 | CDD:293786 | 24/63 (38%) | ||
ANK repeat | 173..199 | CDD:293786 | 8/25 (32%) | ||
Ank | 175..199 | CDD:394980 | 8/23 (35%) | ||
SOCS_box | 268..306 | CDD:400074 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24120 |
Phylome | 1 | 0.910 | - | - | ||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |