Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001162819.1 | Gene: | Ank / 43770 | FlyBaseID: | FBgn0011747 | Length: | 1549 | Species: | Drosophila melanogaster |
Alignment Length: | 278 | Identity: | 90/278 - (32%) |
---|---|---|---|
Similarity: | 154/278 - (55%) | Gaps: | 9/278 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 TPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNS 71
Fly 72 RRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVN 136
Fly 137 AHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANV 201
Fly 202 DTVRCDGATPLFKAAHKGHAAVITVLLK--YRPNLGQLPNGESALHAAAMFGHMTVCKQLVAAGS 264
Fly 265 DVLLKNHDGLTALQLAHQ 282 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 15/58 (26%) |
ANK repeat | 13..40 | CDD:293786 | 4/26 (15%) | ||
ANK | 37..162 | CDD:238125 | 41/124 (33%) | ||
ANK repeat | 42..73 | CDD:293786 | 10/30 (33%) | ||
Ank_2 | 47..137 | CDD:289560 | 31/89 (35%) | ||
ANK repeat | 75..106 | CDD:293786 | 12/30 (40%) | ||
ANK | 103..228 | CDD:238125 | 41/124 (33%) | ||
ANK repeat | 108..137 | CDD:293786 | 12/28 (43%) | ||
Ank_2 | 113..202 | CDD:289560 | 31/88 (35%) | ||
ANK repeat | 141..171 | CDD:293786 | 8/29 (28%) | ||
ANK | 169..292 | CDD:238125 | 39/116 (34%) | ||
ANK repeat | 174..204 | CDD:293786 | 13/29 (45%) | ||
Ank_2 | 179..270 | CDD:289560 | 31/92 (34%) | ||
ANK repeat | 207..237 | CDD:293786 | 11/31 (35%) | ||
ANK repeat | 239..270 | CDD:293786 | 10/30 (33%) | ||
Ank | NP_001162819.1 | ANK | 67..192 | CDD:238125 | |
ANK repeat | 72..103 | CDD:293786 | |||
Ank_2 | 77..167 | CDD:289560 | |||
ANK repeat | 105..136 | CDD:293786 | |||
ANK repeat | 138..169 | CDD:293786 | |||
ANK | 204..320 | CDD:238125 | |||
ANK repeat | 204..231 | CDD:293786 | |||
Ank_2 | 205..295 | CDD:289560 | |||
ANK repeat | 233..264 | CDD:293786 | |||
ANK repeat | 266..295 | CDD:293786 | |||
ANK | 294..419 | CDD:238125 | 5/22 (23%) | ||
ANK repeat | 299..330 | CDD:293786 | |||
Ank_4 | 300..353 | CDD:290365 | |||
ANK repeat | 332..363 | CDD:293786 | |||
Ank_2 | 337..428 | CDD:289560 | 6/31 (19%) | ||
ANK | 360..485 | CDD:238125 | 25/88 (28%) | ||
ANK repeat | 365..395 | CDD:293786 | |||
ANK repeat | 398..427 | CDD:293786 | 6/30 (20%) | ||
ANK repeat | 431..462 | CDD:293786 | 10/30 (33%) | ||
Ank_2 | 436..526 | CDD:289560 | 32/90 (36%) | ||
ANK repeat | 464..494 | CDD:293786 | 12/30 (40%) | ||
ANK | 491..616 | CDD:238125 | 41/124 (33%) | ||
ANK repeat | 496..527 | CDD:293786 | 14/30 (47%) | ||
Ank_2 | 501..592 | CDD:289560 | 32/90 (36%) | ||
ANK repeat | 529..560 | CDD:293786 | 8/30 (27%) | ||
ANK | 557..682 | CDD:238125 | 39/116 (34%) | ||
ANK repeat | 562..590 | CDD:293786 | 12/27 (44%) | ||
Ank_5 | 582..636 | CDD:290568 | 22/54 (41%) | ||
ANK repeat | 595..625 | CDD:293786 | 11/30 (37%) | ||
ANK repeat | 628..657 | CDD:293786 | 10/28 (36%) | ||
Ank_2 | 633..723 | CDD:289560 | 12/39 (31%) | ||
ANK repeat | 661..691 | CDD:293786 | 5/11 (45%) | ||
ANK | 692..812 | CDD:238125 | |||
ANK repeat | 693..724 | CDD:293786 | |||
Ank_2 | 698..788 | CDD:289560 | |||
ANK repeat | 726..755 | CDD:293786 | |||
ANK repeat | 759..788 | CDD:293786 | |||
ZU5 | 930..1034 | CDD:128514 | |||
Death_ank | 1439..1521 | CDD:260029 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm3248 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |