DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and Ank

DIOPT Version :10

Sequence 1:NP_608724.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_787122.1 Gene:Ank / 43770 FlyBaseID:FBgn0011747 Length:1549 Species:Drosophila melanogaster


Alignment Length:278 Identity:90/278 - (32%)
Similarity:154/278 - (55%) Gaps:9/278 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 TPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNS 71
            ||    ||:|..: :.:.::.:|.....::....|.|.|||.:|:..|....|:.||...|..:.
  Fly   401 TP----LHIACKK-NRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADL 460

  Fly    72 RRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVN 136
            ..:.|.|||..||:....|:::||::: |.||..:.:|.|||.||.:.|::.|:..||..||.:|
  Fly   461 PTIRGETPLHLAARANQADIIRILLRS-AKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEIN 524

  Fly   137 AHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANV 201
            |...|:.:.:.|:|:.|...::.:|::.|||.:.....|.|||.:|.:.|:.::.::||||||::
  Fly   525 AQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASI 589

  Fly   202 DTVRCDGATPLFKAAHKGHAAVITVLLK--YRPNLGQLPNGESALHAAAMFGHMTVCKQLVAAGS 264
            |....:..|||..|.|..:.:::.:|||  ..||| ...||:.|:|.|....::.:..||:..|:
  Fly   590 DFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNL-CARNGQCAIHIACKKNYLEIAMQLLQHGA 653

  Fly   265 DVLLKNHDGLTALQLAHQ 282
            ||.:.:..|.:.|.||.|
  Fly   654 DVNIISKSGFSPLHLAAQ 671

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_608724.1 ANKYR 13..277 CDD:440430 84/265 (32%)
ANK repeat 13..40 CDD:293786 4/26 (15%)
ANK repeat 42..73 CDD:293786 10/30 (33%)
ANK repeat 75..106 CDD:293786 12/30 (40%)
ANK repeat 108..137 CDD:293786 12/28 (43%)
ANK repeat 141..171 CDD:293786 8/29 (28%)
ANK repeat 174..204 CDD:293786 13/29 (45%)
ANK repeat 207..237 CDD:293786 11/31 (35%)
ANK repeat 239..270 CDD:293786 10/30 (33%)
AnkNP_787122.1 ANKYR 20..337 CDD:440430
ANK repeat 72..103 CDD:293786
ANK repeat 105..136 CDD:293786
ANK repeat 138..169 CDD:293786
ANK repeat 204..231 CDD:293786
ANKYR 217..502 CDD:440430 32/106 (30%)
ANK repeat 233..264 CDD:293786
ANK repeat 266..295 CDD:293786
ANK repeat 299..330 CDD:293786
ANK repeat 332..363 CDD:293786
ANK repeat 365..395 CDD:293786
ANK repeat 398..427 CDD:293786 6/30 (20%)
ANK repeat 431..462 CDD:293786 10/30 (33%)
ANK repeat 464..494 CDD:293786 12/30 (40%)
ANK repeat 496..527 CDD:293786 14/30 (47%)
ANKYR 510..797 CDD:440430 54/163 (33%)
ANK repeat 529..560 CDD:293786 8/30 (27%)
ANK repeat 562..590 CDD:293786 12/27 (44%)
ANK repeat 595..625 CDD:293786 11/30 (37%)
ANK repeat 628..657 CDD:293786 10/28 (36%)
ANK repeat 661..691 CDD:293786 5/11 (45%)
ANK repeat 693..724 CDD:293786
ANK repeat 726..755 CDD:293786
ANK repeat 759..788 CDD:293786
ZU5 930..1034 CDD:128514
UPA_2 1250..1378 CDD:375346
Death_ank 1439..1521 CDD:260029
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.