DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and asb13a.1

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_009298394.1 Gene:asb13a.1 / 436801 ZFINID:ZDB-GENE-040718-261 Length:311 Species:Danio rerio


Alignment Length:297 Identity:84/297 - (28%)
Similarity:122/297 - (41%) Gaps:69/297 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 TPLILAAAGGHTYCVMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADG 109
            ||:..||:.|....:.:|:..||..|...:...|||..|....|.:.||||::|||.||..:..|
Zfish    21 TPVHEAASLGRALQLQQLIAAGASVNIVSVDNFTPLHDACIQAHPNCVKILLEAGAQVDVRTIHG 85

  Fly   110 GTPLFVACQGGHVKIVRELLDCGANVNAHMKD-RATPVFISAQNGH------RTVLSLLIQAGAE 167
            .|||..||..|.::.|:.|:|.||:||..:.. .|:|:..:...|.      .||..|.:.:   
Zfish    86 STPLCHACAAGSIESVKLLVDHGASVNPSLTALTASPLHEACIRGETCKVCINTVFILYLFS--- 147

  Fly   168 IDIKRIDGATPLWIAAQMGQDHIC-------KVLLQNGANVDTVRCDGATPLFKAAHKGHAAVIT 225
               .|:               |:|       |:::..||.::.......|||..|..|.|.....
Zfish   148 ---SRV---------------HLCAGNPDCVKLMIAKGALLEAFDIYFGTPLHAACAKAHFDCAL 194

  Fly   226 VLLKYRPNLGQLPNG----ESALHAAAMFGHMTVCKQLVAAGSDVLLKNH--------------D 272
            :||    |.|...|.    |:|||.||......:.:.||..|.||.:.::              .
Zfish   195 LLL----NAGAKVNATKFHETALHHAARAEREDLVELLVEFGGDVNISDNLDHIPRDYTKPDSPT 255

  Fly   273 GLTALQ-----LAHQQKYTSICDYLQERIRTMVARSA 304
            .|..||     |:.||    :|..:   |||||...|
Zfish   256 NLCLLQYGSNPLSLQQ----LCRII---IRTMVGTRA 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 9/26 (35%)
ANK repeat 13..40 CDD:293786
ANK 37..162 CDD:238125 43/123 (35%)
ANK repeat 42..73 CDD:293786 9/27 (33%)
Ank_2 47..137 CDD:289560 34/89 (38%)
ANK repeat 75..106 CDD:293786 14/30 (47%)
ANK 103..228 CDD:238125 33/138 (24%)
ANK repeat 108..137 CDD:293786 13/28 (46%)
Ank_2 113..202 CDD:289560 23/102 (23%)
ANK repeat 141..171 CDD:293786 6/36 (17%)
ANK 169..292 CDD:238125 35/152 (23%)
ANK repeat 174..204 CDD:293786 5/36 (14%)
Ank_2 179..270 CDD:289560 27/101 (27%)
ANK repeat 207..237 CDD:293786 10/29 (34%)
ANK repeat 239..270 CDD:293786 12/34 (35%)
asb13a.1XP_009298394.1 ANK repeat 20..49 CDD:293786 9/27 (33%)
Ank_2 24..112 CDD:289560 33/87 (38%)
ANK 46..197 CDD:238125 47/171 (27%)
ANK repeat 51..82 CDD:293786 14/30 (47%)
ANK repeat 84..112 CDD:293786 12/27 (44%)
ANK 151..248 CDD:238125 27/100 (27%)
Ank_2 151..239 CDD:289560 27/91 (30%)
ANK repeat 176..206 CDD:293786 11/33 (33%)
ANK repeat 208..239 CDD:293786 11/30 (37%)
SOCS_ASB13 264..305 CDD:239699 10/29 (34%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.