Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001189070.1 | Gene: | Ank2 / 38863 | FlyBaseID: | FBgn0261788 | Length: | 13559 | Species: | Drosophila melanogaster |
Alignment Length: | 335 | Identity: | 107/335 - (31%) |
---|---|---|---|
Similarity: | 159/335 - (47%) | Gaps: | 42/335 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSLKKETPSDVQ-------LHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYC 58
Fly 59 VMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASV--------------------- 102
Fly 103 ------------DTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHR 155
Fly 156 TVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVRCDGATPLFKAAHKGH 220
Fly 221 AAVITVLLKYRPNL-GQLPNGESALHAAAMFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQK 284
Fly 285 YTSICDYLQE 294 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 24/58 (41%) |
ANK repeat | 13..40 | CDD:293786 | 11/26 (42%) | ||
ANK | 37..162 | CDD:238125 | 48/157 (31%) | ||
ANK repeat | 42..73 | CDD:293786 | 13/30 (43%) | ||
Ank_2 | 47..137 | CDD:289560 | 39/122 (32%) | ||
ANK repeat | 75..106 | CDD:293786 | 13/63 (21%) | ||
ANK | 103..228 | CDD:238125 | 48/124 (39%) | ||
ANK repeat | 108..137 | CDD:293786 | 12/28 (43%) | ||
Ank_2 | 113..202 | CDD:289560 | 34/88 (39%) | ||
ANK repeat | 141..171 | CDD:293786 | 10/29 (34%) | ||
ANK | 169..292 | CDD:238125 | 40/123 (33%) | ||
ANK repeat | 174..204 | CDD:293786 | 15/29 (52%) | ||
Ank_2 | 179..270 | CDD:289560 | 32/91 (35%) | ||
ANK repeat | 207..237 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 239..270 | CDD:293786 | 8/30 (27%) | ||
Ank2 | NP_001189070.1 | ANK repeat | 10..41 | CDD:293786 | |
Ank_4 | 11..64 | CDD:290365 | |||
ANK | 38..163 | CDD:238125 | |||
ANK repeat | 43..74 | CDD:293786 | |||
Ank_2 | 48..135 | CDD:289560 | |||
ANK repeat | 76..107 | CDD:293786 | |||
ANK repeat | 109..134 | CDD:293786 | |||
Ank_4 | 110..163 | CDD:290365 | |||
Ank_4 | 172..225 | CDD:290365 | |||
ANK repeat | 175..202 | CDD:293786 | |||
ANK | 199..324 | CDD:238125 | 11/35 (31%) | ||
ANK repeat | 204..235 | CDD:293786 | |||
Ank_2 | 209..300 | CDD:289560 | 3/10 (30%) | ||
ANK repeat | 237..268 | CDD:293786 | |||
ANK | 266..390 | CDD:238125 | 37/101 (37%) | ||
ANK repeat | 270..300 | CDD:293786 | 3/10 (30%) | ||
ANK repeat | 303..367 | CDD:293786 | 24/64 (38%) | ||
Ank_2 | 308..399 | CDD:289560 | 38/91 (42%) | ||
ANK | 364..489 | CDD:238125 | 35/124 (28%) | ||
ANK repeat | 369..400 | CDD:293786 | 12/30 (40%) | ||
ANK repeat | 402..433 | CDD:293786 | 1/30 (3%) | ||
Ank_4 | 403..456 | CDD:290365 | 9/52 (17%) | ||
ANK repeat | 435..466 | CDD:293786 | 13/30 (43%) | ||
Ank_2 | 440..530 | CDD:289560 | 34/89 (38%) | ||
ANK | 463..588 | CDD:238125 | 43/124 (35%) | ||
ANK repeat | 468..497 | CDD:293786 | 9/28 (32%) | ||
ANK repeat | 501..530 | CDD:293786 | 14/28 (50%) | ||
Ank_2 | 506..597 | CDD:289560 | 32/90 (36%) | ||
ANK | 529..654 | CDD:238125 | 27/94 (29%) | ||
ANK repeat | 535..565 | CDD:293786 | 10/29 (34%) | ||
ANK repeat | 567..598 | CDD:293786 | 8/30 (27%) | ||
Ank_2 | 572..661 | CDD:289560 | 13/51 (25%) | ||
ANK repeat | 600..630 | CDD:293786 | 7/23 (30%) | ||
ANK repeat | 633..662 | CDD:293786 | |||
ANK | 661..785 | CDD:238125 | |||
ANK repeat | 666..697 | CDD:293786 | |||
Ank_2 | 672..762 | CDD:289560 | |||
ANK repeat | 699..730 | CDD:293786 | |||
ANK repeat | 732..762 | CDD:293786 | |||
ZU5 | 927..1030 | CDD:128514 | |||
Death_ank | 1417..1497 | CDD:260029 | |||
ER-remodelling | 11936..>12013 | CDD:258892 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm3248 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |