DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and Ank2

DIOPT Version :10

Sequence 1:NP_608724.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001189070.1 Gene:Ank2 / 38863 FlyBaseID:FBgn0261788 Length:13559 Species:Drosophila melanogaster


Alignment Length:335 Identity:107/335 - (31%)
Similarity:159/335 - (47%) Gaps:42/335 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLKKETPSDVQ-------LHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYC 58
            |.|::..|...:       ||||| :|:.|...|:|...:..||....|..|.|.:||..||...
  Fly   289 MLLERGAPISAKTKNGLAPLHMAA-QGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRV 352

  Fly    59 VMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASV--------------------- 102
            ...|||:.||.|:|.|.|.|||..|.:...|.||::|::.|||:                     
  Fly   353 AKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMN 417

  Fly   103 ------------DTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHR 155
                        |.|:..|.|||.:|.:.....|:|.||..||.|:|..:::.||:.|:::.|:.
  Fly   418 IVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNV 482

  Fly   156 TVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVRCDGATPLFKAAHKGH 220
            .::.||:|.||::|....|..|.|.|||:.|||.:..||::|||.:|.....|.|||...|..||
  Fly   483 DIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGH 547

  Fly   221 AAVITVLLKYRPNL-GQLPNGESALHAAAMFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQK 284
            ..|..:||:...:: .|..||.:.||.|..:.:..|...|:..|:.......:|.|.|.:|.::.
  Fly   548 IKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKN 612

  Fly   285 YTSICDYLQE 294
            ...|...|.|
  Fly   613 QMDIATTLLE 622

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_608724.1 ANKYR 13..277 CDD:440430 99/297 (33%)
ANK repeat 13..40 CDD:293786 11/26 (42%)
ANK repeat 42..73 CDD:293786 13/30 (43%)
ANK repeat 75..106 CDD:293786 13/63 (21%)
ANK repeat 108..137 CDD:293786 12/28 (43%)
ANK repeat 141..171 CDD:293786 10/29 (34%)
ANK repeat 174..204 CDD:293786 15/29 (52%)
ANK repeat 207..237 CDD:293786 10/30 (33%)
ANK repeat 239..270 CDD:293786 8/30 (27%)
Ank2NP_001189070.1 ANKYR 10..308 CDD:440430 3/18 (17%)
ANK repeat 10..41 CDD:293786
ANK repeat 43..74 CDD:293786
ANK repeat 76..107 CDD:293786
ANK repeat 109..134 CDD:293786
ANK repeat 175..202 CDD:293786
ANKYR 190..473 CDD:440430 57/184 (31%)
ANK repeat 204..235 CDD:293786
ANK repeat 237..268 CDD:293786
ANK repeat 270..300 CDD:293786 3/10 (30%)
ANK repeat 303..367 CDD:293786 24/64 (38%)
ANK repeat 369..400 CDD:293786 12/30 (40%)
ANKYR 383..671 CDD:440430 73/240 (30%)
ANK repeat 402..433 CDD:293786 1/30 (3%)
ANK repeat 435..466 CDD:293786 13/30 (43%)
ANK repeat 468..497 CDD:293786 9/28 (32%)
ANK repeat 501..530 CDD:293786 14/28 (50%)
ANK repeat 535..565 CDD:293786 10/29 (34%)
ANK repeat 567..598 CDD:293786 8/30 (27%)
PHA03100 599..>773 CDD:476869 7/24 (29%)
ANK repeat 600..630 CDD:293786 7/23 (30%)
ANK repeat 633..662 CDD:293786
ANK repeat 666..697 CDD:293786
ANK repeat 699..730 CDD:293786
ANK repeat 732..762 CDD:293786
ZU5 930..1027 CDD:459941
UPA_2 1253..1384 CDD:375346
Death_ank 1417..1497 CDD:260029
PTZ00121 <1443..2235 CDD:173412
PTZ00449 <3292..3611 CDD:185628
PTZ00449 <4400..4857 CDD:185628
PTZ00449 <4908..5267 CDD:185628
PTZ00108 <5179..5374 CDD:240271
PTZ00108 <6034..6230 CDD:240271
PTZ00449 <6620..6979 CDD:185628
PTZ00108 <7119..7314 CDD:240271
PTZ00108 <7347..7544 CDD:240271
PTZ00108 <7651..7848 CDD:240271
PTZ00449 <7804..8119 CDD:185628
PTZ00108 <8183..8381 CDD:240271
PTZ00449 <8430..8745 CDD:185628
PTZ00449 <8784..9125 CDD:185628
PTZ00449 <9028..9353 CDD:185628
PHA03307 9225..>9575 CDD:223039
PHA03307 9903..>10259 CDD:223039
PTZ00108 <10177..10451 CDD:240271
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.