DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and Arms

DIOPT Version :10

Sequence 1:NP_608724.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_726059.5 Gene:Arms / 37433 FlyBaseID:FBgn0261554 Length:1642 Species:Drosophila melanogaster


Alignment Length:317 Identity:104/317 - (32%)
Similarity:158/317 - (49%) Gaps:38/317 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HMAAMR---GDEVALLR-VLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNSRRL 74
            |.|.::   .::::.|| :|||..:.:|.:||:.||.|::.|..|.|..|.|.|.:|||..:..|
  Fly   170 HRALLQYIDNNDISGLRAILDSRHLTIDDRDENATTVLMVVAGRGLTAFVREFLARGADVQAEDL 234

  Fly    75 TGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHM 139
            ...|.|..|::.||||||::|:..||.|:.....|.|.|..|...||.::||.|||.||:.|||.
  Fly   235 DNWTALLCASRNGHLDVVQLLLDHGAEVEHRDMGGWTSLMWAAYRGHTELVRLLLDKGADGNAHG 299

  Fly   140 KDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTV 204
            ......:..:|..|::.::.||:|.||::::....|.|.|..|.:.|...|...||:.||||||.
  Fly   300 NYHLGALLWAAGRGYKDIVELLVQRGAKVNVGDKYGTTALVWACRRGNVEIVDTLLKAGANVDTA 364

  Fly   205 RCDGATPLFKAAHKGHAAVITVLLKYRPNLGQL-PNGESALHAAAMFGHMTVCKQLVAAGS---- 264
            .....|||..||..||...::.:|:.:||:..| .:|.:||..|:..|...:...|:|||:    
  Fly   365 GMYSWTPLLVAAAGGHTDCVSSILEKKPNVNALDKDGMTALCIASREGFQDIAASLIAAGAYINI 429

  Fly   265 ---------------------DVLLKNH--------DGLTALQLAHQQKYTSICDYL 292
                                 :.|||.|        |..||:..|.::.:|.|...|
  Fly   430 QDRGADTPLIHAVKAGHRTVVEALLKKHADVDIQGKDRKTAIYTAVEKGHTPIVKLL 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_608724.1 ANKYR 13..277 CDD:440430 99/300 (33%)
ANK repeat 13..40 CDD:293786 8/29 (28%)
ANK repeat 42..73 CDD:293786 12/30 (40%)
ANK repeat 75..106 CDD:293786 13/30 (43%)
ANK repeat 108..137 CDD:293786 13/28 (46%)
ANK repeat 141..171 CDD:293786 7/29 (24%)
ANK repeat 174..204 CDD:293786 13/29 (45%)
ANK repeat 207..237 CDD:293786 10/29 (34%)
ANK repeat 239..270 CDD:293786 11/55 (20%)
ArmsNP_726059.5 ANKYR 172..438 CDD:440430 92/265 (35%)
ANK repeat 205..233 CDD:293786 11/27 (41%)
ANK repeat 235..266 CDD:293786 13/30 (43%)
ANK repeat 268..299 CDD:293786 15/30 (50%)
ANK repeat 301..332 CDD:293786 7/30 (23%)
ANKYR 316..598 CDD:440430 50/171 (29%)
ANK repeat 334..362 CDD:293786 11/27 (41%)
ANK repeat 367..398 CDD:293786 10/30 (33%)
ANK repeat 400..431 CDD:293786 9/30 (30%)
ANK repeat 435..464 CDD:293786 4/28 (14%)
ANK repeat 466..497 CDD:293786 7/21 (33%)
ANK repeat 499..530 CDD:293786
KAP_NTPase 605..1136 CDD:462231
SAM_superfamily 1357..1392 CDD:188886
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.