DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and asb12a

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001119848.1 Gene:asb12a / 322927 ZFINID:ZDB-GENE-030131-1647 Length:305 Species:Danio rerio


Alignment Length:244 Identity:70/244 - (28%)
Similarity:115/244 - (47%) Gaps:29/244 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 VQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDG----TTPLILAAAGGHTYCVMELLDQGADPNS 71
            ::|:.|....|...|..:|...:.......:.|    .|||.:||:.||..|:..||..|||.:.
Zfish    17 LELNRAVADDDHFLLAELLSQERYRKCINQQSGWGIPGTPLRMAASKGHLRCLQLLLAHGADVDR 81

  Fly    72 RRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVN 136
            ..:...||||.|..|.:|..|..|::|||:.:....:..:|:..|.:.|..:|:|:||..||.||
Zfish    82 LDVKAQTPLFTAVCGRYLSCVLALLRAGANPNGSHLNNSSPVLTAAREGDPEILRQLLQHGAEVN 146

  Fly   137 AHMKDR---------ATPVFISAQNGHRTVLSLLIQAGAEIDI----KRIDG-ATPLWIAAQMGQ 187
            |..|..         :.|:::||..||.....:|:..||:.:.    ::::| ||......::..
Zfish   147 ARSKVTLWASGVAVCSGPLYLSAIYGHLDCFKMLLLFGADPNYNSPEEKLNGRATQQKTVMELCL 211

  Fly   188 DHIC-----KVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKYR 231
            .|.|     ::|:..||||..     .|.:.:.:.|.:.|| .:|||.|
Zfish   212 RHGCGVEYIQLLIDFGANVYL-----PTLIIEKSTKQNEAV-ELLLKER 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 19/62 (31%)
ANK repeat 13..40 CDD:293786 5/26 (19%)
ANK 37..162 CDD:238125 44/137 (32%)
ANK repeat 42..73 CDD:293786 14/34 (41%)
Ank_2 47..137 CDD:289560 33/89 (37%)
ANK repeat 75..106 CDD:293786 12/30 (40%)
ANK 103..228 CDD:238125 35/143 (24%)
ANK repeat 108..137 CDD:293786 10/28 (36%)
Ank_2 113..202 CDD:289560 29/107 (27%)
ANK repeat 141..171 CDD:293786 8/42 (19%)
ANK 169..292 CDD:238125 18/73 (25%)
ANK repeat 174..204 CDD:293786 10/35 (29%)
Ank_2 179..270 CDD:289560 15/58 (26%)
ANK repeat 207..237 CDD:293786 8/25 (32%)
ANK repeat 239..270 CDD:293786
asb12aNP_001119848.1 ANK 55..181 CDD:238125 43/125 (34%)
ANK repeat 55..83 CDD:293786 13/27 (48%)
Ank_2 57..148 CDD:289560 34/90 (38%)
ANK repeat 85..116 CDD:293786 12/30 (40%)
ANK repeat 118..148 CDD:293786 11/29 (38%)
Ank_4 119..181 CDD:290365 18/61 (30%)
ANK repeat 162..200 CDD:293786 9/37 (24%)
Ank_2 165..>230 CDD:289560 15/64 (23%)
ANK repeat 202..228 CDD:293786 3/25 (12%)
SOCS 257..297 CDD:295349
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24120
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.