Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001119848.1 | Gene: | asb12a / 322927 | ZFINID: | ZDB-GENE-030131-1647 | Length: | 305 | Species: | Danio rerio |
Alignment Length: | 244 | Identity: | 70/244 - (28%) |
---|---|---|---|
Similarity: | 115/244 - (47%) | Gaps: | 29/244 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 11 VQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDG----TTPLILAAAGGHTYCVMELLDQGADPNS 71
Fly 72 RRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVN 136
Fly 137 AHMKDR---------ATPVFISAQNGHRTVLSLLIQAGAEIDI----KRIDG-ATPLWIAAQMGQ 187
Fly 188 DHIC-----KVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKYR 231 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 19/62 (31%) |
ANK repeat | 13..40 | CDD:293786 | 5/26 (19%) | ||
ANK | 37..162 | CDD:238125 | 44/137 (32%) | ||
ANK repeat | 42..73 | CDD:293786 | 14/34 (41%) | ||
Ank_2 | 47..137 | CDD:289560 | 33/89 (37%) | ||
ANK repeat | 75..106 | CDD:293786 | 12/30 (40%) | ||
ANK | 103..228 | CDD:238125 | 35/143 (24%) | ||
ANK repeat | 108..137 | CDD:293786 | 10/28 (36%) | ||
Ank_2 | 113..202 | CDD:289560 | 29/107 (27%) | ||
ANK repeat | 141..171 | CDD:293786 | 8/42 (19%) | ||
ANK | 169..292 | CDD:238125 | 18/73 (25%) | ||
ANK repeat | 174..204 | CDD:293786 | 10/35 (29%) | ||
Ank_2 | 179..270 | CDD:289560 | 15/58 (26%) | ||
ANK repeat | 207..237 | CDD:293786 | 8/25 (32%) | ||
ANK repeat | 239..270 | CDD:293786 | |||
asb12a | NP_001119848.1 | ANK | 55..181 | CDD:238125 | 43/125 (34%) |
ANK repeat | 55..83 | CDD:293786 | 13/27 (48%) | ||
Ank_2 | 57..148 | CDD:289560 | 34/90 (38%) | ||
ANK repeat | 85..116 | CDD:293786 | 12/30 (40%) | ||
ANK repeat | 118..148 | CDD:293786 | 11/29 (38%) | ||
Ank_4 | 119..181 | CDD:290365 | 18/61 (30%) | ||
ANK repeat | 162..200 | CDD:293786 | 9/37 (24%) | ||
Ank_2 | 165..>230 | CDD:289560 | 15/64 (23%) | ||
ANK repeat | 202..228 | CDD:293786 | 3/25 (12%) | ||
SOCS | 257..297 | CDD:295349 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24120 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 3.010 |