DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and Ankrd44

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_017451840.1 Gene:Ankrd44 / 301415 RGDID:1561893 Length:1074 Species:Rattus norvegicus


Alignment Length:286 Identity:89/286 - (31%)
Similarity:141/286 - (49%) Gaps:22/286 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 LHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNSRRLTGT 77
            ||.||:.| .:.::.:|.:...:::..|:.....|..||..||...|..|::.||:...:...|.
  Rat   144 LHHAALNG-HMEMVNLLLAKGANINAFDKKDRRALHWAAYMGHLDVVALLINHGAEVTCKDKKGY 207

  Fly    78 TPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDR 142
            |||..||..|.::|||.|:..|..:|..:..|.|.|.:||..|...:|.||:|.|||||......
  Rat   208 TPLHAAASNGQINVVKHLLNLGVEIDEINVYGNTALHIACYNGQDAVVNELIDYGANVNQPNNSG 272

  Fly   143 ATPVFISAQNGHRTV-LSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVRC 206
            .||:..:|.:.|..: |.||:..||:::|:..||.:||.:.|..|:....:.|:|||..:|.|..
  Rat   273 FTPLHFAAASTHGALCLELLVNNGADVNIQSKDGKSPLHMTAVHGRFTRSQTLIQNGGEIDCVDK 337

  Fly   207 DGATPLFKAAHKGHAAVITVLLKYRPNLGQLP-NGESALHAAAMFGHMTVCKQLVAAGSDVLLKN 270
            ||.|||..||..||..:|..|:....:..:.. :....||.||:..|...|::|:::|       
  Rat   338 DGNTPLHVAARYGHELLINTLITSGADTAKCGIHSMFPLHLAALNAHSDCCRKLLSSG------- 395

  Fly   271 HDGLTALQLAHQQKYTSICDYLQERI 296
                        |||:.:..:..|.:
  Rat   396 ------------QKYSIVSLFSNEHV 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 16/58 (28%)
ANK repeat 13..40 CDD:293786 6/26 (23%)
ANK 37..162 CDD:238125 44/125 (35%)
ANK repeat 42..73 CDD:293786 9/30 (30%)
Ank_2 47..137 CDD:289560 36/89 (40%)
ANK repeat 75..106 CDD:293786 13/30 (43%)
ANK 103..228 CDD:238125 48/125 (38%)
ANK repeat 108..137 CDD:293786 14/28 (50%)
Ank_2 113..202 CDD:289560 33/89 (37%)
ANK repeat 141..171 CDD:293786 9/30 (30%)
ANK 169..292 CDD:238125 35/123 (28%)
ANK repeat 174..204 CDD:293786 11/29 (38%)
Ank_2 179..270 CDD:289560 28/91 (31%)
ANK repeat 207..237 CDD:293786 11/29 (38%)
ANK repeat 239..270 CDD:293786 8/30 (27%)
Ankrd44XP_017451840.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.