DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and Ankrd42

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_017444434.1 Gene:Ankrd42 / 293117 RGDID:1310789 Length:522 Species:Rattus norvegicus


Alignment Length:318 Identity:82/318 - (25%)
Similarity:138/318 - (43%) Gaps:60/318 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 HMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNSRRLTGTT 78
            |:||:||.:..|..::.:| .::..:|:.|.||:.|||..||::.:..:|..|.||:........
  Rat   104 HVAAIRGQDACLQALIING-ANLATQDDRGCTPVHLAATHGHSFSLQVMLRSGVDPSVTDKREWR 167

  Fly    79 PLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRA 143
            |:.:||..|.|..:::|:|.|..::....:|..|:.:|...||:...:.||   :.||:.:  :|
  Rat   168 PVHYAAFHGRLGCLQLLVKWGCGIEDVDYNGNLPVHLAAMEGHLHCFKFLL---SRVNSAV--QA 227

  Fly   144 TPVFISAQNG-------HRTVLSLLIQ--AGAEIDIKRIDG----ATPLWIAAQMGQDHICKVLL 195
            ...|  ..||       ||.:...::|  .|||.:...:|.    |.|..:||..|...:.|.|:
  Rat   228 LKAF--NDNGENVLDLAHRFLKQNIVQFIQGAEYEGSHLDDQDDLAFPGHVAAFKGDLEMLKKLI 290

  Fly   196 QNGA-NVDTVRCDGATPLFKAAHKGHAAVITVLLKYRPNLGQLPN-----GESALHAAAMFGHMT 254
            .:|. |::....:|:||:.|||.:||...:..|::    :|...|     ||.....|..|.|:.
  Rat   291 DDGVINLNERDENGSTPMHKAAGQGHIDCLQWLVE----MGADSNITNKAGERPSDVAKRFAHLA 351

  Fly   255 VCKQL-----------------------------VAAGSDVLLKNHDGLTALQLAHQQ 283
            ..|.|                             ..|..|:.|...|...|...||::
  Rat   352 AVKLLEGLQKYEIDDIEGDKNHISFFIRHGVEGSTDAKDDLSLSESDKANARMRAHKK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 20/57 (35%)
ANK repeat 13..40 CDD:293786 7/25 (28%)
ANK 37..162 CDD:238125 36/131 (27%)
ANK repeat 42..73 CDD:293786 12/30 (40%)
Ank_2 47..137 CDD:289560 25/89 (28%)
ANK repeat 75..106 CDD:293786 8/30 (27%)
ANK 103..228 CDD:238125 37/138 (27%)
ANK repeat 108..137 CDD:293786 8/28 (29%)
Ank_2 113..202 CDD:289560 27/102 (26%)
ANK repeat 141..171 CDD:293786 10/38 (26%)
ANK 169..292 CDD:238125 35/154 (23%)
ANK repeat 174..204 CDD:293786 10/34 (29%)
Ank_2 179..270 CDD:289560 28/125 (22%)
ANK repeat 207..237 CDD:293786 10/29 (34%)
ANK repeat 239..270 CDD:293786 11/64 (17%)
Ankrd42XP_017444434.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.