| Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_001373103.1 | Gene: | ANK2 / 287 | HGNCID: | 493 | Length: | 4183 | Species: | Homo sapiens |
| Alignment Length: | 317 | Identity: | 106/317 - (33%) |
|---|---|---|---|
| Similarity: | 158/317 - (49%) | Gaps: | 43/317 - (13%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 7 TPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNS 71
Fly 72 RRLTGTTPLFFAAQGGHLDVVKILIKAGASVD------------------------------TPS 106
Fly 107 A---DGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEI 168
Fly 169 DIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKY--R 231
Fly 232 PNLGQLPNGESALHAAAMFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSI 288 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 24/58 (41%) |
| ANK repeat | 13..40 | CDD:293786 | 9/26 (35%) | ||
| ANK | 37..162 | CDD:238125 | 50/157 (32%) | ||
| ANK repeat | 42..73 | CDD:293786 | 14/30 (47%) | ||
| Ank_2 | 47..137 | CDD:289560 | 37/122 (30%) | ||
| ANK repeat | 75..106 | CDD:293786 | 14/60 (23%) | ||
| ANK | 103..228 | CDD:238125 | 45/157 (29%) | ||
| ANK repeat | 108..137 | CDD:293786 | 10/28 (36%) | ||
| Ank_2 | 113..202 | CDD:289560 | 32/88 (36%) | ||
| ANK repeat | 141..171 | CDD:293786 | 11/29 (38%) | ||
| ANK | 169..292 | CDD:238125 | 42/122 (34%) | ||
| ANK repeat | 174..204 | CDD:293786 | 14/29 (48%) | ||
| Ank_2 | 179..270 | CDD:289560 | 31/92 (34%) | ||
| ANK repeat | 207..237 | CDD:293786 | 8/31 (26%) | ||
| ANK repeat | 239..270 | CDD:293786 | 11/30 (37%) | ||
| ANK2 | NP_001373103.1 | Ank_2 | 35..>311 | CDD:423045 | 10/30 (33%) |
| ANK repeat | 80..111 | CDD:293786 | |||
| ANK repeat | 113..144 | CDD:293786 | |||
| ANK repeat | 146..171 | CDD:293786 | |||
| Ank_2 | 202..>444 | CDD:423045 | 53/163 (33%) | ||
| ANK repeat | 212..247 | CDD:293786 | |||
| ANK repeat | 249..280 | CDD:293786 | |||
| ANK repeat | 282..313 | CDD:293786 | 11/32 (34%) | ||
| ANK repeat | 315..345 | CDD:293786 | 14/29 (48%) | ||
| ANK repeat | 348..379 | CDD:293786 | 14/30 (47%) | ||
| ANK repeat | 381..411 | CDD:293786 | 1/29 (3%) | ||
| ANK repeat | 414..445 | CDD:293786 | 11/30 (37%) | ||
| PHA03095 | 421..>706 | CDD:222980 | 59/176 (34%) | ||
| ANK repeat | 447..478 | CDD:293786 | 11/30 (37%) | ||
| ANK repeat | 480..511 | CDD:293786 | 14/30 (47%) | ||
| ANK repeat | 513..542 | CDD:293786 | 8/29 (28%) | ||
| ANK repeat | 546..571 | CDD:293786 | 9/24 (38%) | ||
| Ank_2 | 578..>802 | CDD:423045 | 7/18 (39%) | ||
| ANK repeat | 579..604 | CDD:293786 | 7/17 (41%) | ||
| ANK repeat | 612..643 | CDD:293786 | |||
| ANK repeat | 645..676 | CDD:293786 | |||
| ANK repeat | 678..707 | CDD:293786 | |||
| ANK repeat | 711..742 | CDD:293786 | |||
| ANK repeat | 744..775 | CDD:293786 | |||
| ANK repeat | 777..806 | CDD:293786 | |||
| Ank_4 | 778..830 | CDD:372654 | |||
| ZU5 | 1013..1150 | CDD:128514 | |||
| UPA_2 | 1371..1500 | CDD:375346 | |||
| PspC_subgroup_1 | 1549..>1922 | CDD:411407 | |||
| PTZ00449 | <1717..2161 | CDD:185628 | |||
| Streccoc_I_II | <1843..>2027 | CDD:411384 | |||
| Spc7_N | <2493..>2634 | CDD:373822 | |||
| rad2 | <3031..>3565 | CDD:273166 | |||
| PRK14949 | <3196..>3442 | CDD:237863 | |||
| Death_ank2 | 3614..3697 | CDD:260066 | |||
| NESP55 | <3770..>3884 | CDD:115071 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||