| Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | XP_011542792.1 | Gene: | ANK1 / 286 | HGNCID: | 492 | Length: | 1969 | Species: | Homo sapiens |
| Alignment Length: | 335 | Identity: | 113/335 - (33%) |
|---|---|---|---|
| Similarity: | 161/335 - (48%) | Gaps: | 40/335 - (11%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 13 LHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNSRRLTGT 77
Fly 78 TPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDR 142
Fly 143 ATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVRCD 207
Fly 208 GATPLFKAAHKGHAAVITVLL-KYRPNLGQLPNGESALHAAAMFGHMTVCKQLV-------AAGS 264
Fly 265 DVLLKNH--------------------------DGLTALQLAHQQKYTSICDYLQERIRTMVARS 303
Fly 304 AKAMATSGVS 313 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 24/58 (41%) |
| ANK repeat | 13..40 | CDD:293786 | 9/26 (35%) | ||
| ANK | 37..162 | CDD:238125 | 53/124 (43%) | ||
| ANK repeat | 42..73 | CDD:293786 | 16/30 (53%) | ||
| Ank_2 | 47..137 | CDD:289560 | 42/89 (47%) | ||
| ANK repeat | 75..106 | CDD:293786 | 13/30 (43%) | ||
| ANK | 103..228 | CDD:238125 | 47/124 (38%) | ||
| ANK repeat | 108..137 | CDD:293786 | 14/28 (50%) | ||
| Ank_2 | 113..202 | CDD:289560 | 35/88 (40%) | ||
| ANK repeat | 141..171 | CDD:293786 | 9/29 (31%) | ||
| ANK | 169..292 | CDD:238125 | 43/156 (28%) | ||
| ANK repeat | 174..204 | CDD:293786 | 13/29 (45%) | ||
| Ank_2 | 179..270 | CDD:289560 | 33/98 (34%) | ||
| ANK repeat | 207..237 | CDD:293786 | 11/30 (37%) | ||
| ANK repeat | 239..270 | CDD:293786 | 12/37 (32%) | ||
| ANK1 | XP_011542792.1 | ANK | 47..163 | CDD:238125 | |
| ANK repeat | 47..75 | CDD:293786 | |||
| ANK | 108..229 | CDD:238125 | |||
| ANK repeat | 109..140 | CDD:293786 | |||
| Ank_2 | 114..204 | CDD:289560 | |||
| ANK repeat | 143..173 | CDD:293786 | |||
| ANK | 170..324 | CDD:238125 | |||
| ANK repeat | 175..206 | CDD:293786 | |||
| ANK repeat | 208..232 | CDD:293786 | |||
| ANK repeat | 241..268 | CDD:293786 | |||
| Ank_2 | 242..333 | CDD:289560 | |||
| ANK | 265..390 | CDD:238125 | 7/16 (44%) | ||
| ANK repeat | 271..301 | CDD:293786 | |||
| ANK repeat | 303..334 | CDD:293786 | |||
| Ank_2 | 308..397 | CDD:289560 | 8/23 (35%) | ||
| ANK repeat | 336..367 | CDD:293786 | |||
| ANK repeat | 369..400 | CDD:293786 | 9/26 (35%) | ||
| Ank | 402..432 | CDD:278452 | 15/29 (52%) | ||
| ANK repeat | 405..433 | CDD:293786 | 15/27 (56%) | ||
| ANKYR | 406..619 | CDD:223738 | 85/212 (40%) | ||
| ANK | 430..555 | CDD:238125 | 50/124 (40%) | ||
| ANK repeat | 435..466 | CDD:293786 | 13/30 (43%) | ||
| ANK repeat | 468..499 | CDD:293786 | 15/30 (50%) | ||
| ANK repeat | 501..532 | CDD:293786 | 9/30 (30%) | ||
| ANK | 529..654 | CDD:238125 | 38/124 (31%) | ||
| ANK repeat | 534..563 | CDD:293786 | 13/28 (46%) | ||
| ANK repeat | 568..598 | CDD:293786 | 11/29 (38%) | ||
| ANK repeat | 600..631 | CDD:293786 | 9/30 (30%) | ||
| Ank_2 | 605..696 | CDD:289560 | 20/95 (21%) | ||
| ANK repeat | 633..661 | CDD:293786 | 2/27 (7%) | ||
| ANK repeat | 666..697 | CDD:293786 | 9/35 (26%) | ||
| ANK | 666..695 | CDD:197603 | 8/33 (24%) | ||
| ANK | 694..819 | CDD:238125 | 3/9 (33%) | ||
| ANK repeat | 699..730 | CDD:293786 | 2/4 (50%) | ||
| Ank_2 | 704..795 | CDD:289560 | |||
| ANK repeat | 732..763 | CDD:293786 | |||
| ANK repeat | 765..796 | CDD:293786 | |||
| Ank_5 | 785..839 | CDD:290568 | |||
| ANK repeat | 798..826 | CDD:293786 | |||
| ZU5 | 984..1088 | CDD:128514 | |||
| Death_ank1 | 1474..1557 | CDD:260067 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 1.810 | |||||