DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and Ankle1

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_766344.2 Gene:Ankle1 / 234396 MGIID:1918775 Length:534 Species:Mus musculus


Alignment Length:184 Identity:50/184 - (27%)
Similarity:74/184 - (40%) Gaps:26/184 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 MAAMRGDEV----ALLRVLDSGKVHVDCKDEDGTTPLILAAAGGH---TYCVMELLDQGADPNSR 72
            :||:|.:|.    .|||:.....:.:|    ||...:.|||...|   .:|:..||..|||||:|
Mouse    12 LAALREEEARAVEELLRLGADPNLVLD----DGAAAVHLAARASHPRALHCLRMLLRWGADPNAR 72

  Fly    73 RLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNA 137
            ...|.||:..||..|....:::|:..|........||..||..|.|..|....|.|.:.......
Mouse    73 SAEGLTPVHVAAAWGCCGALELLLSRGGDPTLRDQDGLRPLDWALQQRHHNCARVLQELDTPTQP 137

  Fly   138 HMKDRATPVFISAQNGHRTVL----SLLIQAG-----------AEIDIKRIDGA 176
            ......|..|..||....|..    :|...:|           ||::::.::.|
Mouse   138 DETREPTETFHVAQGSFETETCQGPALAESSGVSQDSELHVHRAELEVEAVEVA 191

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 22/63 (35%)
ANK repeat 13..40 CDD:293786 8/28 (29%)
ANK 37..162 CDD:238125 39/131 (30%)
ANK repeat 42..73 CDD:293786 14/33 (42%)
Ank_2 47..137 CDD:289560 30/92 (33%)
ANK repeat 75..106 CDD:293786 8/30 (27%)
ANK 103..228 CDD:238125 19/89 (21%)
ANK repeat 108..137 CDD:293786 9/28 (32%)
Ank_2 113..202 CDD:289560 16/79 (20%)
ANK repeat 141..171 CDD:293786 9/44 (20%)
ANK 169..292 CDD:238125 1/8 (13%)
ANK repeat 174..204 CDD:293786 1/3 (33%)
Ank_2 179..270 CDD:289560
ANK repeat 207..237 CDD:293786
ANK repeat 239..270 CDD:293786
Ankle1NP_766344.2 ANK 1. /evidence=ECO:0000255 4..35 7/22 (32%)
ANK 26..128 CDD:238125 35/105 (33%)
Ank_2 26..106 CDD:289560 27/83 (33%)
ANK 2. /evidence=ECO:0000255 39..71 13/31 (42%)
ANK repeat 75..106 CDD:293786 8/30 (27%)
ANK 3. /evidence=ECO:0000255 75..104 8/28 (29%)
Ank_4 76..128 CDD:290365 16/51 (31%)
ANK 4. /evidence=ECO:0000255 108..137 9/28 (32%)
LEM 285..322 CDD:295412
GIY-YIG_COG3680_Meta 372..484 CDD:198401
Nuclear localization signal. /evidence=ECO:0000250|UniProtKB:Q8NAG6 498..505
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.