| Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_507912.2 | Gene: | mlt-4 / 180329 | WormBaseID: | WBGene00013835 | Length: | 624 | Species: | Caenorhabditis elegans |
| Alignment Length: | 399 | Identity: | 97/399 - (24%) |
|---|---|---|---|
| Similarity: | 149/399 - (37%) | Gaps: | 108/399 - (27%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 12 QLHMAAMRGDEVALLRVLDSGKVHV-------DC----------------------------KDE 41
Fly 42 DGTTPLILAAAGGHTYC------------VMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKI 94
Fly 95 LI------------------KAG-------ASVDTPSA--------------------DGGTPLF 114
Fly 115 VACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPL 179
Fly 180 WIAAQMGQDHICKVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKYR--PNLGQL-PNGE 241
Fly 242 SALHAAAMFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSICDYLQERIRTMVARSAKA 306
Fly 307 MATSGVSST 315 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 23/105 (22%) |
| ANK repeat | 13..40 | CDD:293786 | 10/61 (16%) | ||
| ANK | 37..162 | CDD:238125 | 40/209 (19%) | ||
| ANK repeat | 42..73 | CDD:293786 | 11/42 (26%) | ||
| Ank_2 | 47..137 | CDD:289560 | 31/146 (21%) | ||
| ANK repeat | 75..106 | CDD:293786 | 10/55 (18%) | ||
| ANK | 103..228 | CDD:238125 | 33/144 (23%) | ||
| ANK repeat | 108..137 | CDD:293786 | 9/28 (32%) | ||
| Ank_2 | 113..202 | CDD:289560 | 22/88 (25%) | ||
| ANK repeat | 141..171 | CDD:293786 | 7/29 (24%) | ||
| ANK | 169..292 | CDD:238125 | 38/125 (30%) | ||
| ANK repeat | 174..204 | CDD:293786 | 9/29 (31%) | ||
| Ank_2 | 179..270 | CDD:289560 | 28/93 (30%) | ||
| ANK repeat | 207..237 | CDD:293786 | 8/31 (26%) | ||
| ANK repeat | 239..270 | CDD:293786 | 15/30 (50%) | ||
| mlt-4 | NP_507912.2 | Ank_2 | 52..152 | CDD:393464 | 19/86 (22%) |
| ANK repeat | 88..128 | CDD:293786 | 2/39 (5%) | ||
| ANKYR | 115..314 | CDD:223738 | 42/203 (21%) | ||
| ANK repeat | 133..168 | CDD:293786 | 10/34 (29%) | ||
| ANK repeat | 170..246 | CDD:293786 | 13/80 (16%) | ||
| PHA03095 | 201..>452 | CDD:222980 | 65/258 (25%) | ||
| ANK repeat | 248..279 | CDD:293786 | 9/30 (30%) | ||
| ANK repeat | 281..312 | CDD:293786 | 7/30 (23%) | ||
| ANK repeat | 346..379 | CDD:293786 | 8/32 (25%) | ||
| ANKYR | 358..559 | CDD:223738 | 32/100 (32%) | ||
| ANK repeat | 381..412 | CDD:293786 | 15/30 (50%) | ||
| ANK repeat | 414..445 | CDD:293786 | 10/37 (27%) | ||
| ANK repeat | 490..528 | CDD:293786 | |||
| ANK repeat | 530..561 | CDD:293786 | |||
| ANK repeat | 563..597 | CDD:293786 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 1 | 1.050 | 81 | 1.000 | Inparanoid score | I3791 |
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.050 | |||||