Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_507152.2 | Gene: | F26D2.10 / 180104 | WormBaseID: | WBGene00009149 | Length: | 1213 | Species: | Caenorhabditis elegans |
Alignment Length: | 262 | Identity: | 56/262 - (21%) |
---|---|---|---|
Similarity: | 89/262 - (33%) | Gaps: | 90/262 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 98 AGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLL- 161
Fly 162 ----IQAGAEIDI----KRIDGATPLWIAAQMGQDHIC--KVLL--------------------- 195
Fly 196 ------------------------QNGAN--VDTVRCDGATPLFKAAHKGHAAVITVLLKYRPNL 234
Fly 235 GQLPNGESALHAAAMFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSICDYLQ--ERIR 297
Fly 298 TM 299 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | |
ANK repeat | 13..40 | CDD:293786 | |||
ANK | 37..162 | CDD:238125 | 13/68 (19%) | ||
ANK repeat | 42..73 | CDD:293786 | |||
Ank_2 | 47..137 | CDD:289560 | 7/38 (18%) | ||
ANK repeat | 75..106 | CDD:293786 | 2/7 (29%) | ||
ANK | 103..228 | CDD:238125 | 35/182 (19%) | ||
ANK repeat | 108..137 | CDD:293786 | 4/28 (14%) | ||
Ank_2 | 113..202 | CDD:289560 | 24/146 (16%) | ||
ANK repeat | 141..171 | CDD:293786 | 7/38 (18%) | ||
ANK | 169..292 | CDD:238125 | 39/175 (22%) | ||
ANK repeat | 174..204 | CDD:293786 | 12/78 (15%) | ||
Ank_2 | 179..270 | CDD:289560 | 30/139 (22%) | ||
ANK repeat | 207..237 | CDD:293786 | 7/29 (24%) | ||
ANK repeat | 239..270 | CDD:293786 | 11/30 (37%) | ||
F26D2.10 | NP_507152.2 | WSN | 28..95 | CDD:197734 | |
Ank_2 | <870..938 | CDD:289560 | 24/78 (31%) | ||
ANK | 872..>944 | CDD:238125 | 25/82 (30%) | ||
ANK repeat | 874..905 | CDD:293786 | 11/32 (34%) | ||
ANK repeat | 907..938 | CDD:293786 | 11/39 (28%) | ||
BRCT | 983..1063 | CDD:214602 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |