| Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_498471.1 | Gene: | F37A4.4 / 175945 | WormBaseID: | WBGene00018134 | Length: | 1163 | Species: | Caenorhabditis elegans |
| Alignment Length: | 277 | Identity: | 68/277 - (24%) |
|---|---|---|---|
| Similarity: | 98/277 - (35%) | Gaps: | 81/277 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 41 EDGTTPLILAAAGGHTYCVMELLDQGAD-PNSRRLT---GTTPLFFAAQGGHLDVVKILIKAGAS 101
Fly 102 VDT-----PSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFIS------AQNGHR 155
Fly 156 TVLSL-LIQAGAEID----------IKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVRCDGA 209
Fly 210 TPLFKAAHKGHAAVITVLLKYRPNLGQLPNGESALHAAAMFGHMTVCKQLVAAGSDVLLKNHDGL 274
Fly 275 TALQL-------AHQQK 284 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 7/31 (23%) |
| ANK repeat | 13..40 | CDD:293786 | |||
| ANK | 37..162 | CDD:238125 | 32/136 (24%) | ||
| ANK repeat | 42..73 | CDD:293786 | 6/31 (19%) | ||
| Ank_2 | 47..137 | CDD:289560 | 25/98 (26%) | ||
| ANK repeat | 75..106 | CDD:293786 | 11/38 (29%) | ||
| ANK | 103..228 | CDD:238125 | 33/146 (23%) | ||
| ANK repeat | 108..137 | CDD:293786 | 9/28 (32%) | ||
| Ank_2 | 113..202 | CDD:289560 | 17/105 (16%) | ||
| ANK repeat | 141..171 | CDD:293786 | 7/46 (15%) | ||
| ANK | 169..292 | CDD:238125 | 34/133 (26%) | ||
| ANK repeat | 174..204 | CDD:293786 | 4/29 (14%) | ||
| Ank_2 | 179..270 | CDD:289560 | 24/90 (27%) | ||
| ANK repeat | 207..237 | CDD:293786 | 11/29 (38%) | ||
| ANK repeat | 239..270 | CDD:293786 | 9/30 (30%) | ||
| F37A4.4 | NP_498471.1 | WSN | 27..95 | CDD:197734 | |
| Ank_2 | 844..>893 | CDD:289560 | 16/59 (27%) | ||
| ANK | <844..893 | CDD:238125 | 16/59 (27%) | ||
| ANK repeat | 856..887 | CDD:293786 | 10/39 (26%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.900 | |||||