DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and ANKAR

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_011508975.1 Gene:ANKAR / 150709 HGNCID:26350 Length:1445 Species:Homo sapiens


Alignment Length:359 Identity:83/359 - (23%)
Similarity:127/359 - (35%) Gaps:95/359 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLKKETPSDVQLH---------MAAMR------GDEVALLRVLDSGKVH----------VDCKD 40
            :.||:...:|.|||         ..||:      |.:.|:.|.| |...|          ::..|
Human   467 LRLKRLPLTDAQLHEQFKKKLGFKRAMKCKSIPFGMKSAVERGL-SAVFHTFSRKTSSSTINVSD 530

  Fly    41 EDGTTPLILAAAGGHTYCVMELLDQGADPNSRRLT----GTTPLFFAAQGGHLDVVKILIKAGAS 101
            |.|.|....||.......:.:|.:.....|.||..    |.|||..|||...|:....|:.:.|.
Human   531 EAGYTIFHHAALHNRVSIICQLCNANFKVNQRRFVTFSQGPTPLHLAAQACSLETTVCLLCSKAD 595

  Fly   102 VDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGA 166
            .......|..|:..|....:|.|:..|  |          |..|..:.|            :|.|
Human   596 YTLSEKRGWMPIHFAAFYDNVCIIIAL--C----------RKDPSLLEA------------EATA 636

  Fly   167 EIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITV---LL 228
            |      :..|||.:||..|.....:.|...|||.......|...:       |.:|:|.   :|
Human   637 E------NQCTPLLLAATSGALDTIQYLFSIGANWRKTDIKGNNII-------HLSVLTFHTEVL 688

  Fly   229 KY--RPNLGQLPNGESALHAAAMFGHMTVC----KQLVAAGSDVLLKNHDGLTALQLAHQQKYTS 287
            ||  :.|:.:||..::.:       .|..|    ::::|..|         |..:.||:.|.:..
Human   689 KYIIKLNIPELPVWKTLV-------EMLQCESYKRRMMAVMS---------LEVICLANDQYWRC 737

  Fly   288 ICD--YLQERIRTMVARSAKAMA-TSGVSSTVKT 318
            |.|  .:...|..:.:...|... |.|:.|.:.|
Human   738 ILDAGTIPALINLLKSSKIKLQCKTVGLLSNIST 771

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 18/83 (22%)
ANK repeat 13..40 CDD:293786 10/51 (20%)
ANK 37..162 CDD:238125 30/128 (23%)
ANK repeat 42..73 CDD:293786 6/30 (20%)
Ank_2 47..137 CDD:289560 23/93 (25%)
ANK repeat 75..106 CDD:293786 10/34 (29%)
ANK 103..228 CDD:238125 27/127 (21%)
ANK repeat 108..137 CDD:293786 7/28 (25%)
Ank_2 113..202 CDD:289560 21/88 (24%)
ANK repeat 141..171 CDD:293786 6/29 (21%)
ANK 169..292 CDD:238125 30/133 (23%)
ANK repeat 174..204 CDD:293786 10/29 (34%)
Ank_2 179..270 CDD:289560 22/99 (22%)
ANK repeat 207..237 CDD:293786 8/34 (24%)
ANK repeat 239..270 CDD:293786 4/34 (12%)
ANKARXP_011508975.1 Ank_2 505..598 CDD:289560 25/93 (27%)
ANK 527..658 CDD:238125 39/160 (24%)
ANK repeat 533..567 CDD:293786 8/33 (24%)
ANK repeat 570..600 CDD:293786 10/29 (34%)
Ank_2 574..669 CDD:289560 30/124 (24%)
ANK repeat 602..636 CDD:293786 11/57 (19%)
ANK repeat 638..663 CDD:293786 7/24 (29%)
ARM <678..771 CDD:237987 23/108 (21%)
armadillo repeat 703..727 CDD:293788 5/39 (13%)
armadillo repeat 737..769 CDD:293788 7/31 (23%)
ARM 738..851 CDD:237987 8/34 (24%)
armadillo repeat 776..812 CDD:293788
armadillo repeat 816..850 CDD:293788
ARM 817..947 CDD:237987
armadillo repeat 858..898 CDD:293788
armadillo repeat 1005..1029 CDD:293788
armadillo repeat 1037..1075 CDD:293788
ARM 1039..1166 CDD:237987
armadillo repeat 1086..1121 CDD:293788
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.