Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_775776.2 | Gene: | ANKRD29 / 147463 | HGNCID: | 27110 | Length: | 301 | Species: | Homo sapiens |
Alignment Length: | 270 | Identity: | 133/270 - (49%) |
---|---|---|---|
Similarity: | 176/270 - (65%) | Gaps: | 0/270 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSLKKETPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQ 65
Fly 66 GADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLD 130
Fly 131 CGANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLL 195
Fly 196 QNGANVDTVRCDGATPLFKAAHKGHAAVITVLLKYRPNLGQLPNGESALHAAAMFGHMTVCKQLV 260
Fly 261 AAGSDVLLKN 270 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 30/58 (52%) |
ANK repeat | 13..40 | CDD:293786 | 12/26 (46%) | ||
ANK | 37..162 | CDD:238125 | 63/124 (51%) | ||
ANK repeat | 42..73 | CDD:293786 | 17/30 (57%) | ||
Ank_2 | 47..137 | CDD:289560 | 48/89 (54%) | ||
ANK repeat | 75..106 | CDD:293786 | 18/30 (60%) | ||
ANK | 103..228 | CDD:238125 | 55/124 (44%) | ||
ANK repeat | 108..137 | CDD:293786 | 15/28 (54%) | ||
Ank_2 | 113..202 | CDD:289560 | 38/88 (43%) | ||
ANK repeat | 141..171 | CDD:293786 | 12/29 (41%) | ||
ANK | 169..292 | CDD:238125 | 50/102 (49%) | ||
ANK repeat | 174..204 | CDD:293786 | 15/29 (52%) | ||
Ank_2 | 179..270 | CDD:289560 | 45/90 (50%) | ||
ANK repeat | 207..237 | CDD:293786 | 17/29 (59%) | ||
ANK repeat | 239..270 | CDD:293786 | 14/30 (47%) | ||
ANKRD29 | NP_775776.2 | ANK repeat | 9..43 | CDD:293786 | 15/33 (45%) |
ANK 1 | 11..41 | 11/29 (38%) | |||
Ank_4 | 14..66 | CDD:290365 | 24/51 (47%) | ||
ANK | 40..165 | CDD:238125 | 63/124 (51%) | ||
ANK repeat | 45..76 | CDD:293786 | 17/30 (57%) | ||
ANK 2 | 45..74 | 16/28 (57%) | |||
Ank_2 | 50..141 | CDD:289560 | 48/90 (53%) | ||
ANK repeat | 78..109 | CDD:293786 | 18/30 (60%) | ||
ANK 3 | 78..107 | 18/28 (64%) | |||
ANK | 108..231 | CDD:238125 | 55/122 (45%) | ||
ANK repeat | 111..141 | CDD:293786 | 15/29 (52%) | ||
ANK 4 | 111..140 | 15/28 (54%) | |||
ANK 5 | 144..173 | 12/28 (43%) | |||
ANK repeat | 144..172 | CDD:293786 | 12/27 (44%) | ||
Ank_4 | 147..198 | CDD:290365 | 22/50 (44%) | ||
ANK repeat | 177..206 | CDD:293786 | 14/28 (50%) | ||
ANK 6 | 177..206 | 14/28 (50%) | |||
Ank_2 | 182..273 | CDD:289560 | 45/90 (50%) | ||
ANK repeat | 210..240 | CDD:293786 | 17/29 (59%) | ||
ANK 7 | 210..239 | 16/28 (57%) | |||
ANK | 241..>292 | CDD:238125 | 15/33 (45%) | ||
ANK repeat | 242..273 | CDD:293786 | 14/30 (47%) | ||
ANK 8 | 242..271 | 13/28 (46%) | |||
Ank_2 | 247..>301 | CDD:289560 | 11/27 (41%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H17839 | |
Inparanoid | 1 | 1.050 | 244 | 1.000 | Inparanoid score | I3301 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53592 | |
OrthoDB | 1 | 1.010 | - | - | D1374335at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0008111 | |
OrthoInspector | 1 | 1.000 | - | - | oto90689 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_108937 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR24120 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X7070 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
12 | 11.940 |