| Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_569059.3 | Gene: | ASB12 / 142689 | HGNCID: | 19763 | Length: | 318 | Species: | Homo sapiens |
| Alignment Length: | 229 | Identity: | 72/229 - (31%) |
|---|---|---|---|
| Similarity: | 107/229 - (46%) | Gaps: | 35/229 - (15%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 4 KKETPSDVQ----LHMAAMRGDEVALLRVL--DSGKVHVDCKDEDGT--TPLILAAAGGHTYCVM 60
Fly 61 ELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIV 125
Fly 126 RELLDCGANVNAHMK---------DRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGA----- 176
Fly 177 ----TPLWIAAQMGQDHIC-----KVLLQNGANV 201 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 21/62 (34%) |
| ANK repeat | 13..40 | CDD:293786 | 6/28 (21%) | ||
| ANK | 37..162 | CDD:238125 | 49/135 (36%) | ||
| ANK repeat | 42..73 | CDD:293786 | 16/32 (50%) | ||
| Ank_2 | 47..137 | CDD:289560 | 39/89 (44%) | ||
| ANK repeat | 75..106 | CDD:293786 | 15/30 (50%) | ||
| ANK | 103..228 | CDD:238125 | 32/122 (26%) | ||
| ANK repeat | 108..137 | CDD:293786 | 11/28 (39%) | ||
| Ank_2 | 113..202 | CDD:289560 | 31/112 (28%) | ||
| ANK repeat | 141..171 | CDD:293786 | 9/29 (31%) | ||
| ANK | 169..292 | CDD:238125 | 11/47 (23%) | ||
| ANK repeat | 174..204 | CDD:293786 | 10/42 (24%) | ||
| Ank_2 | 179..270 | CDD:289560 | 8/28 (29%) | ||
| ANK repeat | 207..237 | CDD:293786 | |||
| ANK repeat | 239..270 | CDD:293786 | |||
| ASB12 | NP_569059.3 | Ank_2 | 8..103 | CDD:289560 | 25/76 (33%) |
| ANK | 75..201 | CDD:238125 | 48/125 (38%) | ||
| ANK repeat | 75..103 | CDD:293786 | 15/27 (56%) | ||
| Ank_2 | 77..168 | CDD:289560 | 40/90 (44%) | ||
| ANK repeat | 105..136 | CDD:293786 | 15/30 (50%) | ||
| ANK repeat | 138..168 | CDD:293786 | 12/29 (41%) | ||
| ANK repeat | 182..208 | CDD:293786 | 8/25 (32%) | ||
| ANK | 184..>250 | CDD:238125 | 18/69 (26%) | ||
| Ank_2 | 185..>250 | CDD:289560 | 17/68 (25%) | ||
| SOCS_box | 277..315 | CDD:284857 | |||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24120 |
| Phylome | 1 | 0.910 | - | - | ||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 2 | 2.010 | |||||