Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_536691.2 | Gene: | Asb7 / 117589 | MGIID: | 2152835 | Length: | 318 | Species: | Mus musculus |
Alignment Length: | 255 | Identity: | 74/255 - (29%) |
---|---|---|---|
Similarity: | 121/255 - (47%) | Gaps: | 9/255 - (3%) |
- Green bases have known domain annotations that are detailed below.
Fly 50 AAAGGHTYCVMELLDQGADPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGG-TPL 113
Fly 114 FVACQGGHVKIVRELLDCGAN---VNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDG 175
Fly 176 ATPLWIAAQMGQDHICKVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLLK-YRPNLGQLPN 239
Fly 240 GESALHAAAMFGHMTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTS--ICDYLQERIR 297 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 9/21 (43%) |
ANK repeat | 13..40 | CDD:293786 | |||
ANK | 37..162 | CDD:238125 | 36/115 (31%) | ||
ANK repeat | 42..73 | CDD:293786 | 9/22 (41%) | ||
Ank_2 | 47..137 | CDD:289560 | 28/90 (31%) | ||
ANK repeat | 75..106 | CDD:293786 | 9/30 (30%) | ||
ANK | 103..228 | CDD:238125 | 34/128 (27%) | ||
ANK repeat | 108..137 | CDD:293786 | 9/32 (28%) | ||
Ank_2 | 113..202 | CDD:289560 | 28/91 (31%) | ||
ANK repeat | 141..171 | CDD:293786 | 10/29 (34%) | ||
ANK | 169..292 | CDD:238125 | 32/125 (26%) | ||
ANK repeat | 174..204 | CDD:293786 | 11/29 (38%) | ||
Ank_2 | 179..270 | CDD:289560 | 22/91 (24%) | ||
ANK repeat | 207..237 | CDD:293786 | 6/30 (20%) | ||
ANK repeat | 239..270 | CDD:293786 | 7/30 (23%) | ||
Asb7 | NP_536691.2 | ANK 1 | 13..42 | 8/20 (40%) | |
PHA02875 | 21..>241 | CDD:165206 | 65/221 (29%) | ||
ANK repeat | 46..77 | CDD:293786 | 9/30 (30%) | ||
ANK 2 | 46..75 | 9/28 (32%) | |||
ANK 3 | 80..109 | 9/28 (32%) | |||
ANK repeat | 81..114 | CDD:293786 | 10/32 (31%) | ||
ANK repeat | 116..147 | CDD:293786 | 10/30 (33%) | ||
ANK 4 | 116..145 | 9/28 (32%) | |||
ANK repeat | 149..180 | CDD:293786 | 11/32 (34%) | ||
ANK 5 | 149..178 | 10/28 (36%) | |||
ANK 6 | 180..208 | 3/27 (11%) | |||
ANK repeat | 213..244 | CDD:293786 | 7/30 (23%) | ||
ANK 7 | 213..242 | 7/28 (25%) | |||
PTZ00322 | 219..>272 | CDD:140343 | 13/52 (25%) | ||
SOCS_ASB7 | 273..317 | CDD:239696 | 1/1 (100%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG53592 | |
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.910 |