Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_009291264.1 | Gene: | ank3a / 103909035 | ZFINID: | ZDB-GENE-060621-1 | Length: | 4499 | Species: | Danio rerio |
Alignment Length: | 309 | Identity: | 100/309 - (32%) |
---|---|---|---|
Similarity: | 159/309 - (51%) | Gaps: | 6/309 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 7 TPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNS 71
Fly 72 RRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVN 136
Fly 137 AHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRIDGATPLWIAAQMGQDHICKVLLQNGANV 201
Fly 202 DTVRCDGATPLFKAAHKGHAAVITVLLKYRPNLG-QLPNGESALHAAAMFGHMTVCKQLVAAGSD 265
Fly 266 VLLKNHDGLTALQLAHQQKYTSICDYLQERIRTMVARSAKAMATSGVSS 314 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 23/58 (40%) |
ANK repeat | 13..40 | CDD:293786 | 8/26 (31%) | ||
ANK | 37..162 | CDD:238125 | 47/124 (38%) | ||
ANK repeat | 42..73 | CDD:293786 | 15/30 (50%) | ||
Ank_2 | 47..137 | CDD:289560 | 35/89 (39%) | ||
ANK repeat | 75..106 | CDD:293786 | 13/30 (43%) | ||
ANK | 103..228 | CDD:238125 | 42/124 (34%) | ||
ANK repeat | 108..137 | CDD:293786 | 11/28 (39%) | ||
Ank_2 | 113..202 | CDD:289560 | 31/88 (35%) | ||
ANK repeat | 141..171 | CDD:293786 | 8/29 (28%) | ||
ANK | 169..292 | CDD:238125 | 35/123 (28%) | ||
ANK repeat | 174..204 | CDD:293786 | 12/29 (41%) | ||
Ank_2 | 179..270 | CDD:289560 | 27/91 (30%) | ||
ANK repeat | 207..237 | CDD:293786 | 9/30 (30%) | ||
ANK repeat | 239..270 | CDD:293786 | 8/30 (27%) | ||
ank3a | XP_009291264.1 | Ank_4 | 48..95 | CDD:290365 | |
ANK | 69..194 | CDD:238125 | |||
ANK repeat | 74..105 | CDD:293786 | |||
Ank_2 | 79..169 | CDD:289560 | |||
ANK repeat | 107..138 | CDD:293786 | |||
ANK repeat | 140..169 | CDD:293786 | |||
Ank_2 | 145..271 | CDD:289560 | |||
ANK repeat | 206..241 | CDD:293786 | |||
ANK | 238..363 | CDD:238125 | 35/88 (40%) | ||
ANK repeat | 243..274 | CDD:293786 | |||
Ank_2 | 248..339 | CDD:289560 | 25/64 (39%) | ||
ANK repeat | 276..307 | CDD:293786 | 10/32 (31%) | ||
ANK repeat | 309..340 | CDD:293786 | 15/30 (50%) | ||
ANK | 338..461 | CDD:238125 | 44/122 (36%) | ||
ANK repeat | 342..373 | CDD:293786 | 13/30 (43%) | ||
Ank_2 | 347..438 | CDD:289560 | 32/90 (36%) | ||
ANK repeat | 375..406 | CDD:293786 | 13/30 (43%) | ||
ANK | 403..528 | CDD:238125 | 38/124 (31%) | ||
ANK repeat | 408..439 | CDD:293786 | 8/30 (27%) | ||
Ank_2 | 413..504 | CDD:289560 | 28/90 (31%) | ||
ANK repeat | 441..472 | CDD:293786 | 13/30 (43%) | ||
ANK | 469..594 | CDD:238125 | 28/114 (25%) | ||
ANK repeat | 474..505 | CDD:293786 | 9/30 (30%) | ||
Ank_2 | 479..569 | CDD:289560 | 22/89 (25%) | ||
ANK repeat | 507..536 | CDD:293786 | 8/28 (29%) | ||
ANK repeat | 540..569 | CDD:293786 | 7/28 (25%) | ||
Ank_2 | 545..634 | CDD:289560 | 8/38 (21%) | ||
ANK | 569..693 | CDD:238125 | 3/14 (21%) | ||
ANK repeat | 573..602 | CDD:293786 | 2/10 (20%) | ||
ANK repeat | 606..634 | CDD:293786 | |||
ANK repeat | 639..670 | CDD:293786 | |||
Ank_4 | 640..693 | CDD:290365 | |||
ANK | 667..792 | CDD:238125 | |||
ANK repeat | 675..703 | CDD:293786 | |||
Ank_2 | 677..768 | CDD:289560 | |||
ANK repeat | 705..736 | CDD:293786 | |||
ANK repeat | 738..769 | CDD:293786 | |||
Ank_5 | 758..812 | CDD:290568 | |||
ANK repeat | 771..799 | CDD:293786 | |||
ZU5 | 995..1099 | CDD:128514 | |||
Death_ank3 | 3886..3969 | CDD:176781 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |