DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and CDKN2D

DIOPT Version :10

Sequence 1:NP_608724.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001791.1 Gene:CDKN2D / 1032 HGNCID:1790 Length:166 Species:Homo sapiens


Alignment Length:194 Identity:62/194 - (31%)
Similarity:88/194 - (45%) Gaps:39/194 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 LKKETPSDVQLHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGA 67
            |.:|..:..:|..||.|||...:.|:|....||.|..:..|.|.|.:...|. |...:|||.|||
Human     2 LLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGS-TAIALELLKQGA 65

  Fly    68 DPNSRRLTGTTPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCG 132
            .||.:..:||:|:..||:.|.||.:|:|::.||.|:.|...|                       
Human    66 SPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTG----------------------- 107

  Fly   133 ANVNAHMKDRATPVFISAQNGHRTVLSLLIQAGAEIDIKRID--GATPLWIAAQMGQDHICKVL 194
                      |.|:.::.|.||..|:|.|   .||.|:.|.|  |.|||.:|.|.|...:..:|
Human   108 ----------ALPIHLAVQEGHTAVVSFL---AAESDLHRRDARGLTPLELALQRGAQDLVDIL 158

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_608724.1 ANKYR 13..277 CDD:440430 60/184 (33%)
ANK repeat 13..40 CDD:293786 11/26 (42%)
ANK repeat 42..73 CDD:293786 13/30 (43%)
ANK repeat 75..106 CDD:293786 13/30 (43%)
ANK repeat 108..137 CDD:293786 1/28 (4%)
ANK repeat 141..171 CDD:293786 11/29 (38%)
ANK repeat 174..204 CDD:293786 9/23 (39%)
ANK repeat 207..237 CDD:293786
ANK repeat 239..270 CDD:293786
CDKN2DNP_001791.1 ANKYR <15..161 CDD:440430 59/181 (33%)
ANK repeat 41..71 CDD:293786 13/30 (43%)
ANK 1 41..69 12/28 (43%)
ANK repeat 73..104 CDD:293786 13/30 (43%)
ANK 2 73..102 13/28 (46%)
ANK repeat 106..136 CDD:293786 13/65 (20%)
ANK 3 106..135 12/64 (19%)
ANK 4 138..166 8/21 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.