DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and ANKRD61

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001258629.1 Gene:ANKRD61 / 100310846 HGNCID:22467 Length:418 Species:Homo sapiens


Alignment Length:317 Identity:79/317 - (24%)
Similarity:128/317 - (40%) Gaps:59/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PLILAAAGGHTYCVMELLDQGADPNSRRLTGTTPL------------------------FFAAQG 86
            |:.|||.......::.||..||||..|..||.|.|                        ....|.
Human    79 PIHLAAKYHKAQSLLCLLRHGADPEVRDTTGLTTLNLMLLHWPVTSTTWAKPGNRTHRILTDIQN 143

  Fly    87 GHLDVVKILIKAGASVDTPS--ADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFIS 149
            ..:..::||...||.|:|..  ::..:||.:|...|...::..|...||:|||..:...||:.::
Human   144 SSITCLRILCAHGAQVNTQGEISNKRSPLHLAIAYGCYPVLSILTQNGADVNAINEASMTPLHMA 208

  Fly   150 AQNGHRTVLSLLIQAGAEIDIK-RIDGATPLWIAA---------QMGQDHIC-KVLLQNGANVDT 203
            |...::.::..||..||.::.. ...|.|||.:|.         .:|....| ::||.:||.|:.
Human   209 ANMLNKEMMETLIAYGANVNCAVSSTGNTPLKLAVCTASSKAGRLLGAGVSCIRLLLTHGAKVNA 273

  Fly   204 VRCDGATPLFKAAHKGHAAVITVLLKYRPNLGQLP-NGESALH--------------AAAMFGH- 252
            ....|.|.:.:|...|..|:|.:||::..|:..|. ||||.::              .|.:..| 
Human   274 QDYKGQTAIHEACFGGREAIINLLLEFEANVNILTRNGESPIYMYLQRSCNVRDTALLARLLYHT 338

  Fly   253 ----MTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSICDYLQERIRTMVARSAK 305
                ||..:.::.||  ::|.....|....:...||..|:....:..||.:.....|
Human   339 YPLRMTNNQGILPAG--IMLPEFRLLRDTLIKQSQKPLSLQGICKRNIRNIYGEKYK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 10/25 (40%)
ANK repeat 13..40 CDD:293786
ANK 37..162 CDD:238125 35/141 (25%)
ANK repeat 42..73 CDD:293786 10/26 (38%)
Ank_2 47..137 CDD:289560 29/115 (25%)
ANK repeat 75..106 CDD:293786 11/54 (20%)
ANK 103..228 CDD:238125 36/137 (26%)
ANK repeat 108..137 CDD:293786 8/28 (29%)
Ank_2 113..202 CDD:289560 27/99 (27%)
ANK repeat 141..171 CDD:293786 7/29 (24%)
ANK 169..292 CDD:238125 37/153 (24%)
ANK repeat 174..204 CDD:293786 12/39 (31%)
Ank_2 179..270 CDD:289560 30/120 (25%)
ANK repeat 207..237 CDD:293786 9/29 (31%)
ANK repeat 239..270 CDD:293786 11/49 (22%)
ANKRD61NP_001258629.1 ANK 1 27..57
ANK <32..115 CDD:295348 15/35 (43%)
ANK 2 75..104 10/24 (42%)
ANK 79..221 CDD:238125 35/141 (25%)
ANK repeat 79..106 CDD:293786 10/26 (38%)
Ank_2 80..198 CDD:289560 31/117 (26%)
ANK repeat 108..163 CDD:293786 11/54 (20%)
ANK 3 132..161 6/28 (21%)
ANK 166..298 CDD:238125 35/131 (27%)
ANK 4 167..196 8/28 (29%)
ANK repeat 169..198 CDD:293786 10/28 (36%)
Ank_2 172..275 CDD:289560 28/102 (27%)
ANK repeat 200..232 CDD:293786 7/31 (23%)
ANK 5 200..229 7/28 (25%)
ANK repeat 234..275 CDD:293786 12/40 (30%)
ANK 6 234..273 12/38 (32%)
Ank_5 263..317 CDD:290568 19/53 (36%)
ANK 272..>351 CDD:238125 18/78 (23%)
ANK repeat 277..308 CDD:293786 9/30 (30%)
ANK 7 277..306 9/28 (32%)
ANK 8 310..343 6/32 (19%)
ANK repeat 319..345 CDD:293786 3/25 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4177
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.