Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001258629.1 | Gene: | ANKRD61 / 100310846 | HGNCID: | 22467 | Length: | 418 | Species: | Homo sapiens |
Alignment Length: | 317 | Identity: | 79/317 - (24%) |
---|---|---|---|
Similarity: | 128/317 - (40%) | Gaps: | 59/317 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 PLILAAAGGHTYCVMELLDQGADPNSRRLTGTTPL------------------------FFAAQG 86
Fly 87 GHLDVVKILIKAGASVDTPS--ADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFIS 149
Fly 150 AQNGHRTVLSLLIQAGAEIDIK-RIDGATPLWIAA---------QMGQDHIC-KVLLQNGANVDT 203
Fly 204 VRCDGATPLFKAAHKGHAAVITVLLKYRPNLGQLP-NGESALH--------------AAAMFGH- 252
Fly 253 ----MTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSICDYLQERIRTMVARSAK 305 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 10/25 (40%) |
ANK repeat | 13..40 | CDD:293786 | |||
ANK | 37..162 | CDD:238125 | 35/141 (25%) | ||
ANK repeat | 42..73 | CDD:293786 | 10/26 (38%) | ||
Ank_2 | 47..137 | CDD:289560 | 29/115 (25%) | ||
ANK repeat | 75..106 | CDD:293786 | 11/54 (20%) | ||
ANK | 103..228 | CDD:238125 | 36/137 (26%) | ||
ANK repeat | 108..137 | CDD:293786 | 8/28 (29%) | ||
Ank_2 | 113..202 | CDD:289560 | 27/99 (27%) | ||
ANK repeat | 141..171 | CDD:293786 | 7/29 (24%) | ||
ANK | 169..292 | CDD:238125 | 37/153 (24%) | ||
ANK repeat | 174..204 | CDD:293786 | 12/39 (31%) | ||
Ank_2 | 179..270 | CDD:289560 | 30/120 (25%) | ||
ANK repeat | 207..237 | CDD:293786 | 9/29 (31%) | ||
ANK repeat | 239..270 | CDD:293786 | 11/49 (22%) | ||
ANKRD61 | NP_001258629.1 | ANK 1 | 27..57 | ||
ANK | <32..115 | CDD:295348 | 15/35 (43%) | ||
ANK 2 | 75..104 | 10/24 (42%) | |||
ANK | 79..221 | CDD:238125 | 35/141 (25%) | ||
ANK repeat | 79..106 | CDD:293786 | 10/26 (38%) | ||
Ank_2 | 80..198 | CDD:289560 | 31/117 (26%) | ||
ANK repeat | 108..163 | CDD:293786 | 11/54 (20%) | ||
ANK 3 | 132..161 | 6/28 (21%) | |||
ANK | 166..298 | CDD:238125 | 35/131 (27%) | ||
ANK 4 | 167..196 | 8/28 (29%) | |||
ANK repeat | 169..198 | CDD:293786 | 10/28 (36%) | ||
Ank_2 | 172..275 | CDD:289560 | 28/102 (27%) | ||
ANK repeat | 200..232 | CDD:293786 | 7/31 (23%) | ||
ANK 5 | 200..229 | 7/28 (25%) | |||
ANK repeat | 234..275 | CDD:293786 | 12/40 (30%) | ||
ANK 6 | 234..273 | 12/38 (32%) | |||
Ank_5 | 263..317 | CDD:290568 | 19/53 (36%) | ||
ANK | 272..>351 | CDD:238125 | 18/78 (23%) | ||
ANK repeat | 277..308 | CDD:293786 | 9/30 (30%) | ||
ANK 7 | 277..306 | 9/28 (32%) | |||
ANK 8 | 310..343 | 6/32 (19%) | |||
ANK repeat | 319..345 | CDD:293786 | 3/25 (12%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4177 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.900 |