DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and ANKRD61

DIOPT Version :10

Sequence 1:NP_608724.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:NP_001258629.1 Gene:ANKRD61 / 100310846 HGNCID:22467 Length:418 Species:Homo sapiens


Alignment Length:317 Identity:79/317 - (24%)
Similarity:128/317 - (40%) Gaps:59/317 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PLILAAAGGHTYCVMELLDQGADPNSRRLTGTTPL------------------------FFAAQG 86
            |:.|||.......::.||..||||..|..||.|.|                        ....|.
Human    79 PIHLAAKYHKAQSLLCLLRHGADPEVRDTTGLTTLNLMLLHWPVTSTTWAKPGNRTHRILTDIQN 143

  Fly    87 GHLDVVKILIKAGASVDTPS--ADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPVFIS 149
            ..:..::||...||.|:|..  ::..:||.:|...|...::..|...||:|||..:...||:.::
Human   144 SSITCLRILCAHGAQVNTQGEISNKRSPLHLAIAYGCYPVLSILTQNGADVNAINEASMTPLHMA 208

  Fly   150 AQNGHRTVLSLLIQAGAEIDIK-RIDGATPLWIAA---------QMGQDHIC-KVLLQNGANVDT 203
            |...::.::..||..||.::.. ...|.|||.:|.         .:|....| ::||.:||.|:.
Human   209 ANMLNKEMMETLIAYGANVNCAVSSTGNTPLKLAVCTASSKAGRLLGAGVSCIRLLLTHGAKVNA 273

  Fly   204 VRCDGATPLFKAAHKGHAAVITVLLKYRPNLGQLP-NGESALH--------------AAAMFGH- 252
            ....|.|.:.:|...|..|:|.:||::..|:..|. ||||.::              .|.:..| 
Human   274 QDYKGQTAIHEACFGGREAIINLLLEFEANVNILTRNGESPIYMYLQRSCNVRDTALLARLLYHT 338

  Fly   253 ----MTVCKQLVAAGSDVLLKNHDGLTALQLAHQQKYTSICDYLQERIRTMVARSAK 305
                ||..:.::.||  ::|.....|....:...||..|:....:..||.:.....|
Human   339 YPLRMTNNQGILPAG--IMLPEFRLLRDTLIKQSQKPLSLQGICKRNIRNIYGEKYK 393

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_608724.1 ANKYR 13..277 CDD:440430 73/287 (25%)
ANK repeat 13..40 CDD:293786
ANK repeat 42..73 CDD:293786 10/26 (38%)
ANK repeat 75..106 CDD:293786 11/54 (20%)
ANK repeat 108..137 CDD:293786 8/28 (29%)
ANK repeat 141..171 CDD:293786 7/29 (24%)
ANK repeat 174..204 CDD:293786 12/39 (31%)
ANK repeat 207..237 CDD:293786 9/29 (31%)
ANK repeat 239..270 CDD:293786 11/49 (22%)
ANKRD61NP_001258629.1 ANK 1 27..57
ANK 2 75..104 10/24 (42%)
ANK repeat 79..106 CDD:293786 10/26 (38%)
Ank_2 80..198 CDD:463710 31/117 (26%)
ANK repeat 108..163 CDD:293786 11/54 (20%)
ANK 3 132..161 6/28 (21%)
ANKYR <149..335 CDD:440430 50/185 (27%)
ANK 4 167..196 8/28 (29%)
ANK repeat 169..198 CDD:293786 10/28 (36%)
ANK repeat 200..232 CDD:293786 7/31 (23%)
ANK 5 200..229 7/28 (25%)
ANK repeat 234..275 CDD:293786 12/40 (30%)
ANK 6 234..273 12/38 (32%)
ANK repeat 277..308 CDD:293786 9/30 (30%)
ANK 7 277..306 9/28 (32%)
ANK 8 310..343 6/32 (19%)
ANK repeat 319..345 CDD:293786 3/25 (12%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.