DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG3104 and ankef1b

DIOPT Version :9

Sequence 1:NP_001259969.1 Gene:CG3104 / 33486 FlyBaseID:FBgn0031473 Length:321 Species:Drosophila melanogaster
Sequence 2:XP_021322982.1 Gene:ankef1b / 100149106 ZFINID:ZDB-GENE-060810-68 Length:530 Species:Danio rerio


Alignment Length:145 Identity:49/145 - (33%)
Similarity:78/145 - (53%) Gaps:2/145 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 MRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVME-LLDQGADPNSRRLTGTTPLF 81
            :|..::..||:..:.:|.||.||:...|||:.|.:.|: |.|.| |:..|||.|:......|||.
Zfish   370 VRSGDLESLRLAFAQQVPVDIKDQFYKTPLLTACSCGN-YQVAEFLISLGADVNAVDQFSWTPLH 433

  Fly    82 FAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELLDCGANVNAHMKDRATPV 146
            .|...||:|::.:|:::||.||..:.:|.|||..|.:......|..|:..||||.|..|.....:
Zfish   434 HACHAGHVDIINMLVQSGAVVDAVAMNGATPLMRAIESCRFSSVECLITAGANVMAENKQGQNCL 498

  Fly   147 FISAQNGHRTVLSLL 161
            .|:...|:..::.|:
Zfish   499 DIAMIYGNARIVQLI 513

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG3104NP_001259969.1 Ank_2 <13..72 CDD:289560 21/54 (39%)
ANK repeat 13..40 CDD:293786 6/21 (29%)
ANK 37..162 CDD:238125 44/126 (35%)
ANK repeat 42..73 CDD:293786 13/31 (42%)
Ank_2 47..137 CDD:289560 34/90 (38%)
ANK repeat 75..106 CDD:293786 12/30 (40%)
ANK 103..228 CDD:238125 17/59 (29%)
ANK repeat 108..137 CDD:293786 11/28 (39%)
Ank_2 113..202 CDD:289560 13/49 (27%)
ANK repeat 141..171 CDD:293786 3/21 (14%)
ANK 169..292 CDD:238125
ANK repeat 174..204 CDD:293786
Ank_2 179..270 CDD:289560
ANK repeat 207..237 CDD:293786
ANK repeat 239..270 CDD:293786
ankef1bXP_021322982.1 ANK 10..137 CDD:238125
ANK repeat 53..82 CDD:293786
ANK repeat 84..115 CDD:293786
ANK repeat 117..148 CDD:293786
Ank_4 118..170 CDD:316185
ANK 389..513 CDD:238125 43/124 (35%)
ANK repeat 397..425 CDD:293786 13/28 (46%)
ANK repeat 427..458 CDD:293786 12/30 (40%)
ANK repeat 460..491 CDD:293786 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.