Sequence 1: | NP_001259969.1 | Gene: | CG3104 / 33486 | FlyBaseID: | FBgn0031473 | Length: | 321 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_021335899.1 | Gene: | ank3b / 100126016 | ZFINID: | ZDB-GENE-060621-2 | Length: | 3985 | Species: | Danio rerio |
Alignment Length: | 372 | Identity: | 109/372 - (29%) |
---|---|---|---|
Similarity: | 165/372 - (44%) | Gaps: | 77/372 - (20%) |
- Green bases have known domain annotations that are detailed below.
Fly 13 LHMAAMRGDEVALLRVLDSGKVHVDCKDEDGTTPLILAAAGGHTYCVMELLDQGADPNSRRLTGT 77
Fly 78 TPLFFAAQGGHLDVVKILIKAGASVDTPSADGGTPLFVACQGGHVKIVRELL------------- 129
Fly 130 ------------------DCGANVNAHM------KDRATPVFISAQNGHRTVLSLLIQAGAEIDI 170
Fly 171 KRIDGATPLWIAAQMGQDHICKVLLQNGANVDTVRCDGATPLFKAAHKGHAAVITVLL-KYRPNL 234
Fly 235 GQLPNGES---------------------------------ALHAAAMFGHMTVCKQLVAAGSDV 266
Fly 267 LLKNHDGLTALQLAHQQKYTSICDYLQERIRTMVARSAKAMATSGVS 313 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG3104 | NP_001259969.1 | Ank_2 | <13..72 | CDD:289560 | 18/58 (31%) |
ANK repeat | 13..40 | CDD:293786 | 7/26 (27%) | ||
ANK | 37..162 | CDD:238125 | 51/161 (32%) | ||
ANK repeat | 42..73 | CDD:293786 | 11/30 (37%) | ||
Ank_2 | 47..137 | CDD:289560 | 40/120 (33%) | ||
ANK repeat | 75..106 | CDD:293786 | 16/30 (53%) | ||
ANK | 103..228 | CDD:238125 | 47/161 (29%) | ||
ANK repeat | 108..137 | CDD:293786 | 15/59 (25%) | ||
Ank_2 | 113..202 | CDD:289560 | 33/125 (26%) | ||
ANK repeat | 141..171 | CDD:293786 | 11/29 (38%) | ||
ANK | 169..292 | CDD:238125 | 44/156 (28%) | ||
ANK repeat | 174..204 | CDD:293786 | 10/29 (34%) | ||
Ank_2 | 179..270 | CDD:289560 | 35/124 (28%) | ||
ANK repeat | 207..237 | CDD:293786 | 13/30 (43%) | ||
ANK repeat | 239..270 | CDD:293786 | 14/63 (22%) | ||
ank3b | XP_021335899.1 | ANK | 67..192 | CDD:238125 | 45/115 (39%) |
ANK repeat | 72..103 | CDD:293786 | 7/26 (27%) | ||
ANK repeat | 105..136 | CDD:293786 | 11/30 (37%) | ||
ANK repeat | 138..167 | CDD:293786 | 16/28 (57%) | ||
Ank_4 | 201..262 | CDD:316185 | 10/60 (17%) | ||
ANK repeat | 204..239 | CDD:293786 | 3/34 (9%) | ||
ANK | 236..361 | CDD:238125 | 38/124 (31%) | ||
ANK repeat | 241..272 | CDD:293786 | 11/30 (37%) | ||
ANK repeat | 274..305 | CDD:293786 | 10/30 (33%) | ||
ANK repeat | 307..332 | CDD:293786 | 11/24 (46%) | ||
ANK repeat | 340..371 | CDD:293786 | 3/30 (10%) | ||
ANK | 368..493 | CDD:238125 | 21/80 (26%) | ||
ANK repeat | 376..404 | CDD:293786 | 11/27 (41%) | ||
ANK repeat | 406..437 | CDD:293786 | 7/35 (20%) | ||
ANK repeat | 439..470 | CDD:293786 | 2/4 (50%) | ||
ANK | 467..592 | CDD:238125 | |||
ANK repeat | 472..503 | CDD:293786 | |||
ANK repeat | 505..536 | CDD:293786 | |||
ANK repeat | 538..567 | CDD:293786 | |||
ANK | 567..691 | CDD:238125 | |||
ANK repeat | 571..602 | CDD:293786 | |||
ANK repeat | 604..635 | CDD:293786 | |||
ANK repeat | 637..668 | CDD:293786 | |||
ANK | 665..790 | CDD:238125 | |||
ANK repeat | 670..701 | CDD:293786 | |||
ANK repeat | 703..734 | CDD:293786 | |||
ANK repeat | 736..767 | CDD:293786 | |||
ANK repeat | 769..797 | CDD:293786 | |||
Ank_4 | 770..822 | CDD:316185 | |||
ZU5 | 1020..1122 | CDD:128514 | |||
Death_ank3 | 3451..3534 | CDD:176781 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 2.000 |