DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and AT5G57500

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_200558.1 Gene:AT5G57500 / 835854 AraportID:AT5G57500 Length:318 Species:Arabidopsis thaliana


Alignment Length:214 Identity:37/214 - (17%)
Similarity:81/214 - (37%) Gaps:64/214 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 SQPNTTSPSTARPVLFLLLGIGIGYLITKVLVWPIMD----------LKSHTNRTGASTSLDIDL 69
            |.|.:.......|..|.::.:.:...|.::....::.          :.:.::.|...:|..:| 
plant     3 SSPRSEGRKFIIPSFFFIIALCVLAFINEIRFDSLLSFGRCALSNVPMNNGSSETPLLSSSPVD- 66

  Fly    70 TDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVELPVSPYF----RES 130
             ||:|:|..:.|.|           :.:.||....:.:.::   |:...|::.|...|    :|.
plant    67 -DEIRILIGILTLP-----------DQYSRRHFLRMIYGTQ---NVPDGVKVDVKFVFCNLTKED 116

  Fly   131 WLKTKMALKYLHDHHL-------------------------NDAD-------WFLEADDETYVVM 163
             .|..:||:.:....:                         |:.|       :.::|||:||:.:
plant   117 -QKVLVALEIMRYDDIIILNCNENMNKGKTYTYFSSLPDIFNETDAQKPPYHYVMKADDDTYIRL 180

  Fly   164 ENLRYMVYPYSPQLAIYFG 182
            |:|...:.|. |:..:|:|
plant   181 ESLVASLRPL-PREDLYYG 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 23/133 (17%)
AT5G57500NP_200558.1 Galactosyl_T 83..225 CDD:419759 23/121 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.