DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and b3glcta

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001289180.1 Gene:b3glcta / 799443 ZFINID:ZDB-GENE-110411-147 Length:496 Species:Danio rerio


Alignment Length:253 Identity:55/253 - (21%)
Similarity:92/253 - (36%) Gaps:60/253 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 LKSHTNRTGASTSLDIDLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLT 116
            :.||:...|....::       .:...|.|....|..:...|.:|||::.:.|.::|..:|.::.
Zfish   254 VSSHSPLCGEPVKIE-------NIFVAVKTCKKFHSDRVPVVKKTWGKQASLLEYYSDYADPSIP 311

  Fly   117 GSVELPVSPYFRESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYMV--YPYSPQLAI 179
             ::.|.|....|....||...|:.....|:...||.|..||:|.:.:..|:.::  |..|..|.:
Zfish   312 -TINLGVPNTERGHCGKTFAILRRFLSSHVPRTDWLLIVDDDTLISLPRLQALLSCYESSEPLCL 375

  Fly   180 --------------YF-GSPGTVMSRAALRRLVELSLPNPSKCE-QKNAGPTAEKLRECLENVNV 228
                          |. |..|.:.||.|:.:|:.      |.|. ..|..|....|..||.::.|
Zfish   376 GERYGYGLGQGGYSYITGGGGMLFSREAVVQLLS------SGCNCYSNDAPDDMVLGMCLNSLRV 434

  Fly   229 LAGNTYDSEGRRRMYLIEPQARSNLFLHYDSNIWFWKFLAYRTQDGIFAWSNYAVSFH 286
                              |...|.||.......:...||:::|          .:|||
Zfish   435 ------------------PVTHSPLFHQARPEDYARDFLSHQT----------PISFH 464

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 27/114 (24%)
b3glctaNP_001289180.1 Galactosyl_T 265..468 CDD:304462 52/242 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.