DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and C1galt1c1

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_067525.1 Gene:C1galt1c1 / 59048 MGIID:1913493 Length:316 Species:Mus musculus


Alignment Length:297 Identity:80/297 - (26%)
Similarity:127/297 - (42%) Gaps:65/297 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IDLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVELPVSPYFRESW 131
            ::|:...||.|.|..||.:....| ||.|||.:.|:|..|||| .::.:..|:.:..:    :.|
Mouse    59 MELSKSFRVYCIVLVKPKDVSLWA-AVKETWTKHCDKAEFFSS-ENVKVFESINMDTN----DMW 117

  Fly   132 LKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYFG-------------S 183
            |..:.|.||.:|.:.:..:||..|...|:.|:|||:|.:.........|.|             .
Mouse   118 LMMRKAYKYAYDQYRDQYNWFFLARPTTFAVIENLKYFLLKKDQSQPFYLGHTVKSGDLEYVSVD 182

  Fly   184 PGTVMSRAALRRLVELSLPNPSKCEQKNAGPTAEKLRE------CLENVNVLAGNTYDSEGR--- 239
            .|.|:|..:::||..| |..|.||.::  |....|:.|      ||:...|.|.|..|::|:   
Mouse   183 GGIVLSIESMKRLNSL-LSVPEKCPEQ--GGMIWKISEDKQLAVCLKYAGVFAENAEDADGKDVF 244

  Fly   240 --RRMYLIEPQARSNLFLHYDSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYR 302
              :.:.|...:|.:|     ..|         :..:|  ..|:.||:|:.:....:|...|.:||
Mouse   245 NTKSVGLFIKEAMTN-----QPN---------QVVEG--CCSDMAVTFNGLTPNQMHVMMYGVYR 293

  Fly   303 LRTFGR--KQIVESLPPKYNPAAEKDQGAPRIGSDQD 337
            ||.||.  ...:..|||.              ||:.|
Mouse   294 LRAFGHVFNDALVFLPPN--------------GSEND 316

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 30/110 (27%)
C1galt1c1NP_067525.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.