DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and CG34452

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001097611.2 Gene:CG34452 / 5740876 FlyBaseID:FBgn0085481 Length:318 Species:Drosophila melanogaster


Alignment Length:265 Identity:76/265 - (28%)
Similarity:118/265 - (44%) Gaps:49/265 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 RVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSV--ELPVSPYFRESWLKTKM 136
            |:.|.:.|....|...|..:..||.|.|:..:|.|...|.:|..:|  .:|      :.|.:.:.
  Fly    53 RIFCIISTYAYRHGHAAIHIHRTWVRHCDHYLFVSDDIDNHLEPAVFMNMP------DKWHRMRA 111

  Fly   137 ALKYLHDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYFG--------------SPGTV 187
            .|:|::.:|.:..||||..:|:.:||::|||:|:..|||:..||||              ..|.|
  Fly   112 YLEYVYKYHFHQGDWFLYCNDDNFVVVDNLRHMLKTYSPKELIYFGCKLRTTNGLVFMLEGSGIV 176

  Fly   188 MSRAALRRLVELSLPNPSKCEQKNAG-PTAEKLRECLENVNVLAGNTYDSEGRRRMYLIEPQARS 251
            .|.|||:|....:|.|.|.|..:..| ...::|..||.||||:||::.|...|.|          
  Fly   177 FSAAALKRFALTALTNESICSSETKGNDFTKELGRCLTNVNVIAGDSRDEFQRHR---------- 231

  Fly   252 NLFLHYDSNI--------------WFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYR 302
              ||.:|:::              :|.....|...|.....|.:::.||......|:...|..|:
  Fly   232 --FLPFDADLHLGSSMNESLENHKYFLDHSYYPVNDMNLPVSLHSICFHVPYTLNIYDLYYFAYK 294

  Fly   303 LRTFG 307
            .|.||
  Fly   295 TRIFG 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 34/113 (30%)
CG34452NP_001097611.2 Galactosyl_T 72..>183 CDD:304462 37/116 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458876
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.