DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and C1GALT1

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_064541.1 Gene:C1GALT1 / 56913 HGNCID:24337 Length:363 Species:Homo sapiens


Alignment Length:329 Identity:101/329 - (30%)
Similarity:161/329 - (48%) Gaps:58/329 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 LFLLLGIGIGYLITKVLVWPIMDLK--------------SHTNRTG------------------- 60
            |..|.|..||:|:...|...::..|              .|::..|                   
Human    10 LTFLCGSAIGFLLCSQLFSILLGEKVDTQPNVLHNDPHARHSDDNGQNHLEGQMNFNADSSQHKD 74

  Fly    61 ASTSLDIDLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVELPVSP 125
            .:|.:..:|..:||:||:|.|.|.|.:.:|:.|..||.:||||::|.||..:.:.. :|.|....
Human    75 ENTDIAENLYQKVRILCWVMTGPQNLEKKAKHVKATWAQRCNKVLFMSSEENKDFP-AVGLKTKE 138

  Fly   126 YFRESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYF--------- 181
            ...:.:.||..|.:|:|:|:|.||||||:|||:|||:::|||:::..|.|:..|||         
Human   139 GRDQLYWKTIKAFQYVHEHYLEDADWFLKADDDTYVILDNLRWLLSKYDPEEPIYFGRRFKPYVK 203

  Fly   182 -----GSPGTVMSRAALRRLVELSLPNPSKCEQKNAGPTAEKLR--ECLENVNVLAGNTYDSEGR 239
                 |..|.|:|:.||:|.|:..  ...||...:   :.|.|.  .|:|.:||.||::.|:.|:
Human   204 QGYMSGGAGYVLSKEALKRFVDAF--KTDKCTHSS---SIEDLALGRCMEIMNVEAGDSRDTIGK 263

  Fly   240 RRMYLIEPQARSNLFLHY-DSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYRL 303
            ...:...|:  .:|...| ....|:|.:..|...:|....|:.|||||||....::..||::|.|
Human   264 ETFHPFVPE--HHLIKGYLPRTFWYWNYNYYPPVEGPGCCSDLAVSFHYVDSTTMYELEYLVYHL 326

  Fly   304 RTFG 307
            |.:|
Human   327 RPYG 330

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 41/111 (37%)
C1GALT1NP_064541.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 41..72 2/30 (7%)
Galactosyl_T 107..>221 CDD:328824 44/114 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165153888
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3251
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.900

Return to query results.
Submit another query.