DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and LOC564281

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_692721.4 Gene:LOC564281 / 564281 -ID:- Length:341 Species:Danio rerio


Alignment Length:335 Identity:100/335 - (29%)
Similarity:154/335 - (45%) Gaps:69/335 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 PVLFLLLGIGIGYLITKVLVW---------PIMDLKSHTNRTGASTSLDI--DLTDEVRVLCYVY 80
            |.|.|..||.:|::..:.||:         |...|.||......:...|:  .|...|||||::.
Zfish    20 PHLLLFCGILLGFVFVQQLVYLRIEGRTLTPAHILSSHAKSHAWNKKADLVQSLYPRVRVLCWIM 84

  Fly    81 TKPINHKTQAQAVLETWGRRCNKLIFFSSR-SDLNLTGSVELPVSPYFRESWLKTKMALKYLHDH 144
            |:|.|.:.:.|.|..||.:.||.:::.||: ||....|   |.||....:.:.||..|.:::..|
Zfish    85 TRPENLQKRLQHVNATWAQHCNLVLYMSSQSSDFPTVG---LNVSEGRSQLYWKTIRAFQHIQKH 146

  Fly   145 HLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYF--------------GSPGTVMSRAALRR 195
            ||..|||||:|||:|:||:|||||::..:..:..:||              |..|.|:||.||||
Zfish   147 HLQHADWFLKADDDTFVVLENLRYLLSQHDTEKPLYFGHKFRPFVRQGYMSGGAGYVLSREALRR 211

  Fly   196 LVELSLPNP----SKCEQKNAGPTAEKLRECLENVNVLAGNTYDSEGRRRMYLIEPQARSNLFLH 256
            .|:..:...    |..|....|       .|:|.:.|.|.:|.|:..|.......|...   .:|
Zfish   212 FVQGFVTGRCTHFSSLEDMALG-------RCMEIMGVKAVDTRDANLRETFNPFWPDKH---LIH 266

  Fly   257 YDSNIWFWKFLAYRTQDGIFAW----------SNYAVSFHYVQHRYIHCFEYMIYRLRTFGRKQI 311
            .|:.         :.||.::::          |::.:||||::...::..||..|.||.||.|. 
Zfish   267 KDNT---------KKQDSLYSYYKTKLGPECCSDFVISFHYLRAADMYMLEYYTYHLRPFGYKY- 321

  Fly   312 VESLPPKYNP 321
                  ::||
Zfish   322 ------RFNP 325

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 39/112 (35%)
LOC564281XP_692721.4 Galactosyl_T <153..>244 CDD:304462 32/97 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
44.020

Return to query results.
Submit another query.