DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and c1galt1a

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001070842.1 Gene:c1galt1a / 557675 ZFINID:ZDB-GENE-061013-303 Length:408 Species:Danio rerio


Alignment Length:297 Identity:99/297 - (33%)
Similarity:152/297 - (51%) Gaps:35/297 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LVW-----PIMDLKSHTNRTGASTSLDIDLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKL 104
            |.|     .:::|| |.|:.|....:..:|..:||:||:|.|.|.|.:::||.|..||.|.||.:
Zfish    60 LTWRVEGSALINLK-HPNQPGEDGHIADELFKKVRILCWVMTGPSNLQSKAQHVKNTWSRHCNVV 123

  Fly   105 IFFSSRSDLNLTGSVELPVSPYFRESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYM 169
            :|.||..|.:.. :|.|.......:.:.||..|..|...:|.::|||||:|||:|:||::|||::
Zfish   124 LFMSSEEDRSFP-TVGLGTGEGRDQLYWKTIRAFHYALKNHGHEADWFLKADDDTFVVVDNLRWI 187

  Fly   170 VYPYSPQLAIYF--------------GSPGTVMSRAALRRLVELSLPNPSKCEQKNAGPTAE-KL 219
            :..|:|:..|||              |..|.|:|:.||||.||..  :...|  .:..|..: .:
Zfish   188 LSNYTPEQPIYFGKRFKPYTKQGYMSGGAGYVLSKEALRRFVEGF--STKVC--THTTPVEDLAM 248

  Fly   220 RECLENVNVLAGNTYDSEGRRRMYLIEPQARSNLFLHYDSNIWFWKFLAYRTQDGIFAWSNYAVS 284
            .:|||.:.||||::.||..|...:...|:  .:|...:....|:|.:..|...:|....|:.|||
Zfish   249 GQCLEKMGVLAGDSRDSLHRETFHPFIPE--HHLTGKFSKTFWYWNYCYYPIVEGPQCCSDLAVS 311

  Fly   285 FHYVQHRYIHCFEYMIYRLRTFGRKQIVESLPPKYNP 321
            ||||....::..||..|.||.||.:.       :|.|
Zfish   312 FHYVDPVLMYTLEYYTYHLRPFGYQH-------RYQP 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 39/111 (35%)
c1galt1aNP_001070842.1 Galactosyl_T <169..292 CDD:304462 42/128 (33%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 356..408
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.