DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and mfng

DIOPT Version :10

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001007789.1 Gene:mfng / 493633 ZFINID:ZDB-GENE-041130-1 Length:360 Species:Danio rerio


Alignment Length:275 Identity:55/275 - (20%)
Similarity:94/275 - (34%) Gaps:60/275 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 IDLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIF-FSSRSDLNLTGS----VELPVSPY 126
            ::|:|   :...|.|....||::...:||||.....:..: |:...|.:::..    |....||.
Zfish    81 LELSD---IFIAVKTTGRFHKSRLALLLETWISETKEHTYIFTDSPDADISSEGFNVVVTNCSPE 142

  Fly   127 FRESWLKTKMALKYLHDHHL-NDADWFLEADDETYVVMENLRYMVYPYSPQLAIYFGSPGTVMSR 190
            .....|..|||.:|  |:.: :...|....||:.|:....|..::..:.....||.|.|.  :.|
Zfish   143 HSHQALSCKMAAEY--DYFMASYKKWLCHVDDDNYLNPGALLSLLMAFPADGDIYVGKPS--LDR 203

  Fly   191 AALRRLVELSLPNPSK-------------CEQKN---------AGPTAEKLR-------ECLE-- 224
            .  .|..||...|.::             |..:|         :||..|:..       :|..  
Zfish   204 P--MRAQELLEGNKTRDVHFWFATGGAGFCLSRNLAERMAPWASGPRFEQTSAVIMLPDDCTVGF 266

  Fly   225 ------NVNVLAGNTYDSEGRRRMYLIEPQARSNLFLHYDSNIWFWKFLAYRTQDGIFAWSNYAV 283
                  .::::..|.:.|.....:.|........:.|.|.   ||...:......|:|.......
Zfish   267 IVERRLGISMIHSNMFHSHLENLLLLSPSDIPKQVTLSYG---WFESKMNSVELKGVFTKDEDPS 328

  Fly   284 SFHYVQHRYIHCFEY 298
            .|     |.:||..|
Zfish   329 RF-----RTVHCLLY 338

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:473923 25/103 (24%)
mfngNP_001007789.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 51..74
Fringe 81..329 CDD:367085 50/259 (19%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.