DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and c1galt1c1

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001004886.1 Gene:c1galt1c1 / 448225 XenbaseID:XB-GENE-941230 Length:317 Species:Xenopus tropicalis


Alignment Length:300 Identity:74/300 - (24%)
Similarity:128/300 - (42%) Gaps:61/300 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 STSLDIDLTDEVRVLCYVYTKP--INHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVELPVS 124
            |.|..::|:..::|.|.:..:|  ::|..   ||.|||.:.|:|..::|| ..:.:..|:.:..:
 Frog    55 SESERLELSHSMQVYCIILVRPKDLSHWA---AVRETWSKHCDKADYYSS-EPMKVFESISVDTN 115

  Fly   125 PYFRESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYFG------- 182
                :.|...:.|::..::::.|..:||......|:.|:|||:|.:....|....|.|       
 Frog   116 ----DLWAMMRKAIQMTYENNKNAYNWFFICTPSTFAVIENLKYFLLQKDPSQPYYLGHTVKSGD 176

  Fly   183 ------SPGTVMSRAALRRLVELSLPNPSKCEQKNAGPTAEKLRE------CLENVNVLAGNTYD 235
                  :.|.|:|..:|.||..: ...|.||.::  |....|:.|      ||:...|||.|..|
 Frog   177 LDYVDIAGGIVLSIESLHRLFSI-FKEPEKCPEQ--GGLIFKMSEDKQLAMCLKYKGVLAENAED 238

  Fly   236 SEGRRRMYLIEPQARSNLFLHYDSNIWFWKFLAYRTQ---DGIFAWSNYAVSFHYVQHRYIHCFE 297
            |||:            |:|..........:.:|...|   :|  ..|:.|::|..:...::|...
 Frog   239 SEGK------------NVFNTKSVGTLIQETMANNPQKVVEG--CCSDMAITFSGISPNFMHVMM 289

  Fly   298 YMIYRLRTFGRKQIVESLPPKYNPAAEKDQGAPRIGSDQD 337
            |.:||||.:|.         .:|.|....   |:..||.|
 Frog   290 YGVYRLRAYGH---------SFNDALVFH---PKPDSDND 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 25/110 (23%)
c1galt1c1NP_001004886.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1407357at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.