DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and CG34057

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001033980.2 Gene:CG34057 / 3885645 FlyBaseID:FBgn0054057 Length:355 Species:Drosophila melanogaster


Alignment Length:317 Identity:110/317 - (34%)
Similarity:169/317 - (53%) Gaps:30/317 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RPVLFLLLGIGIGYLITKVL----VWPIMDLKSHTNR------TGASTSLDIDLTDEVRVLCYVY 80
            |.::||:|||.:|..:|..:    :|...||::....      ..:...|...|..|||:||.|.
  Fly    23 RNIIFLVLGIMLGIRLTDFIGYLKLWRNNDLRASEKAALLKYPVASEEHLATWLRREVRILCLVL 87

  Fly    81 TKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVELPVSPYFRESWLKTKMALKYLHDHH 145
            |.|.:|.|:|..|..|||.|||||||.||::|.|| ..:::..|...:..:.|.:..:.|:|.|:
  Fly    88 TMPSSHATKAALVNRTWGARCNKLIFMSSQTDSNL-NILQINKSESRKNLYAKVRTGMAYVHKHY 151

  Fly   146 LNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYF--------------GSPGTVMSRAALRRL 196
            ||:.||||:|||:||:||||||..:|||.|:.::||              |..|.|:||.|||||
  Fly   152 LNEYDWFLKADDDTYIVMENLRLFLYPYDPESSVYFGCRFKAYFSQGYMSGGGGYVLSRDALRRL 216

  Fly   197 VELSLPNPSKCEQKNAGPTAEKLRECLENVNVLAGNTYDSEGRRRMYLIEPQARSNLFLHYDSNI 261
            ...:|.:.:.| :.|......::..||::|.|:||:|.|.:|..|...:.|   ..:|....||.
  Fly   217 NLFALNSTTIC-KLNGESEDVQIGHCLQDVGVIAGDTRDFQGHHRFLPVNP---FTVFPTILSNS 277

  Fly   262 WFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYRLRTFGRKQIVESLPPK 318
            |...:..::........:: |:|||||:......||:.:|.:|.||..:...:||.:
  Fly   278 WLEGYFFHKPNKSDCCAAS-AISFHYVKDFEFELFEFFLYYMRVFGLHRTPRALPSR 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 48/111 (43%)
CG34057NP_001033980.2 Galactosyl_T 93..>243 CDD:304462 61/151 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449723
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.