DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and B3glct

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:XP_030110487.1 Gene:B3glct / 381694 MGIID:2685903 Length:582 Species:Mus musculus


Alignment Length:264 Identity:55/264 - (20%)
Similarity:96/264 - (36%) Gaps:66/264 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 HKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVELPVSPYFRESWLKTKMALKYLHDHHLNDAD 150
            |..:...|.:||..:.:.:.::|..::..:. :|:|.:....|....||...|:...:|..|...
Mouse   364 HADRIPIVKKTWAAQASLIEYYSDYAETAIP-TVDLGIPNTDRGHCGKTFAILEKFLNHSHNKIS 427

  Fly   151 WFLEADDETYVVMENLRYMVYPYSPQLAIYF-----------------GSPGTVMSRAALRRLVE 198
            |.:..||:|.:.:..||:::..|.....::.                 |..|.|.||.|:|||  
Mouse   428 WLVIVDDDTLISISRLRHLLSCYDSSDPVFLGERYGYGLGTGGYSYVTGGGGMVFSREAIRRL-- 490

  Fly   199 LSLPNPSKCEQKNAGPTAEKLRECLENVNVLAGNTYDSEGRRRMYLIEPQARSNLFLHYDSNIWF 263
              |.:..:| ..|..|....|..|...:.|                  |...|.|| |....:.:
Mouse   491 --LVSSCRC-YSNDAPDDMVLGMCFSGLGV------------------PVTHSPLF-HQARPVDY 533

  Fly   264 WK-FLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYRLRTFGRKQIVESLPPKYNPAAEKDQ 327
            .| :||::          ..|||    |::.|.....:|         :....|.:.:.|.::.|
Mouse   534 PKDYLAHQ----------IPVSF----HKHWHIDPVKVY---------LTWLAPSEEDQATQETQ 575

  Fly   328 GAPR 331
            ..||
Mouse   576 KDPR 579

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 21/114 (18%)
B3glctXP_030110487.1 Galactosyl_T 348..550 CDD:389837 48/224 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.