DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and CG34056

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001033979.1 Gene:CG34056 / 38106 FlyBaseID:FBgn0054056 Length:341 Species:Drosophila melanogaster


Alignment Length:329 Identity:118/329 - (35%)
Similarity:173/329 - (52%) Gaps:36/329 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RPVLFLLLGIGIGYLITKVLVW-----------PIMDLKSHTNRTGASTSLDIDLTDEVRVLCYV 79
            |.:|.|:||:.||..:|..|.:           .|..|:...::......|.:.|.:|.||||.|
  Fly     3 RNILCLVLGLIIGIQLTDFLEYFQLTDSQFASTSITQLEEGASQLATEEELALWLHNETRVLCMV 67

  Fly    80 YTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSVELPVSPYFRESWLKTKMALKYLHDH 144
            .|.|.||:::.:.|..|||||||||||.||:.|..| |.:::.|.......:||.:.||:|::.:
  Fly    68 LTLPKNHQSRVRRVKGTWGRRCNKLIFISSQEDREL-GVIDVGVPEDRNNLYLKMRKALEYVYRN 131

  Fly   145 HLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYF--------------GSPGTVMSRAALRR 195
            |..|.||||:|||:|:|:|||||:::|||.|:.|:||              |..|.||||.||||
  Fly   132 HGEDYDWFLKADDDTFVIMENLRFLLYPYDPEAALYFGHRFRTTFPQGYMSGGAGYVMSRDALRR 196

  Fly   196 LVELSLPNPSKCEQKNAGPTAEKLRECLENVNVLAGNTYDSEGRRRMYLIEPQARSNLFLHYDSN 260
            |...:..|...|...| .....::..||:||.|:||::.|.|||.|..   |.:...:...:.::
  Fly   197 LNLFAFNNSQFCPINN-NSEDRQIGFCLQNVGVVAGDSRDEEGRDRFL---PLSLKFMLPTFPTD 257

  Fly   261 IWFWKFLAYR--TQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYRLRTFGRKQIVESLPPKYNPAA 323
            .|..|...|.  .:.|    |...:|||||:......:||::|||..||......:|||:..|..
  Fly   258 NWLPKLTFYEPVNETG----STSGISFHYVKIHEFEMYEYLLYRLHIFGTPLSQRTLPPRLGPDE 318

  Fly   324 EKDQ 327
            .::|
  Fly   319 LQNQ 322

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 48/111 (43%)
CG34056NP_001033979.1 Galactosyl_T 67..>226 CDD:304462 67/160 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458860
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.