DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and C1GalTA

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_609258.1 Gene:C1GalTA / 34215 FlyBaseID:FBgn0032078 Length:388 Species:Drosophila melanogaster


Alignment Length:343 Identity:129/343 - (37%)
Similarity:191/343 - (55%) Gaps:50/343 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 STARPVLFLLLGIGIGYLITKVLVW---------------------------------PIMDLKS 54
            |..|..:.|::|:.:|:.:.::.|:                                 |..|:..
  Fly    17 SNKRSFVSLIVGLIVGFCLAELFVYSTPERSEFMPYDGHRHGDVNDAHHSHDMMEMSGPEQDVGG 81

  Fly    55 HTNRTGASTSLDIDLTDEVRVLCYVYTKPINHKTQAQAVLETWGRRCNKLIFFSSRSDLNLTGSV 119
            |.:....||..: .|..||||||::.|.|.||:.:|:.|..|||:|||||||.||..|..| .:|
  Fly    82 HEHVHENSTIAE-RLYSEVRVLCWIMTNPSNHQKKARHVKRTWGKRCNKLIFMSSAKDDEL-DAV 144

  Fly   120 ELPVSPYFRESWLKTKMALKYLHDHHLNDADWFLEADDETYVVMENLRYMVYPYSPQLAIYF--- 181
            .|||.......|.|||.|.||:::||:|||||||:|||:||.::||:|||:|||||:..:||   
  Fly   145 ALPVGEGRNNLWGKTKEAYKYIYEHHINDADWFLKADDDTYTIVENMRYMLYPYSPETPVYFGCK 209

  Fly   182 -----------GSPGTVMSRAALRRLVELSLPNPSKCEQKNAGPTAEKLRECLENVNVLAGNTYD 235
                       |..|.|:||.|:||.|..:||||..|:..|:|....::.:||:|||||||::.|
  Fly   210 FKPYVKQGYMSGGAGYVLSREAVRRFVVEALPNPKLCKSDNSGAEDVEIGKCLQNVNVLAGDSRD 274

  Fly   236 SEGRRRMYLIEPQARSNLFLHYDSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMI 300
            |.||.|.:...|: ...:..|.|...|:|:::.|:|.:|:...|:.|:|||||....::..:|:|
  Fly   275 SNGRGRFFPFVPE-HHLIPSHTDKKFWYWQYIFYKTDEGLDCCSDNAISFHYVSPNQMYVLDYLI 338

  Fly   301 YRLRTFGRKQIVESLPPK 318
            |.||.:|.....::||.|
  Fly   339 YHLRPYGIINTPDALPNK 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 55/111 (50%)
C1GalTANP_609258.1 Galactosyl_T 119..>265 CDD:304462 70/146 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45458868
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D103727at6656
OrthoFinder 1 1.000 - - FOG0000473
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR23033
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.950

Return to query results.
Submit another query.