DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG2983 and CG9109

DIOPT Version :9

Sequence 1:NP_608723.2 Gene:CG2983 / 33485 FlyBaseID:FBgn0031472 Length:344 Species:Drosophila melanogaster
Sequence 2:NP_001285650.1 Gene:CG9109 / 33844 FlyBaseID:FBgn0031765 Length:546 Species:Drosophila melanogaster


Alignment Length:285 Identity:56/285 - (19%)
Similarity:89/285 - (31%) Gaps:95/285 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 HKTQAQAVLETWGRRCNKLIFFSSRSDLNL----TGSVELPVSPYFRESWLKTKMALKYLHDHHL 146
            ||.:...:..||........::|..:|:.:    ||      .|..:.......||:..|....:
  Fly   285 HKERIPIIERTWAADARNRRYYSDVADVGIPAIGTG------IPNVQTGHCAKTMAILQLSLKDI 343

  Fly   147 N---DADWFLEADDETYVVME-----------------------NLRYMVYPYSPQL------AI 179
            .   |..|.:..||:|.:.:.                       .|.|:...|..:|      ..
  Fly   344 GKQLDIRWLMLVDDDTLLSLHLIHTHLPTSVPRVSALLCRHNATELVYLGQRYGYRLHAPDGFNY 408

  Fly   180 YFGSPGTVMSRAALRRLVE-LSLPNPSKCEQKNAGPTAEKLRECLENVNV----LAGNTYDSEGR 239
            :.|..|.|:|...:|.:|: .|.|:.|       .|....|..||:.:.|    :||        
  Fly   409 HTGGAGIVLSLPLVRLIVQRCSCPSAS-------APDDMILGYCLQALGVPAIHVAG-------- 458

  Fly   240 RRMYLIEPQARSNLFLHYDSNIWFWKFLAYRTQDGIFAWSNYAVSFHYVQHRYIHCFEYMIYRLR 304
              |:...||..:...|...:.:.|.||           |:...      :|.|          .|
  Fly   459 --MHQARPQDYAGELLQLHAPLTFHKF-----------WNTDP------EHTY----------RR 494

  Fly   305 TFGRKQIVESLPPKYNPAAEKDQGA 329
            ..|...:..|.|    .||.|:|.|
  Fly   495 WLGGSMVNRSAP----LAAHKEQPA 515

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG2983NP_608723.2 Galactosyl_T 86..>184 CDD:304462 22/133 (17%)
CG9109NP_001285650.1 Fringe 269..486 CDD:190308 45/234 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.